Align RhaS, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate WP_012706828.1 NGR_RS12580 rhamnose ABC transporter substrate-binding protein
Query= TCDB::Q7BSH5 (331 letters) >NCBI__GCF_000018545.1:WP_012706828.1 Length = 329 Score = 443 bits (1140), Expect = e-129 Identities = 221/331 (66%), Positives = 275/331 (83%), Gaps = 2/331 (0%) Query: 1 MKLAKTLALGVALAVAMMAGTASAKDIKIGLVVKSLGNGFFDAANKGAQEAAKELGGVEV 60 MK+ K+L + A+A A+MA A A++ KI LVVK+LG GFF+AANKGAQEAAKELG VE+ Sbjct: 1 MKILKSLMVTAAVAAALMANAAHAENKKIALVVKALGIGFFEAANKGAQEAAKELGDVEI 60 Query: 61 IYTGPTSTTAEGQIEVINSLIAQGVDAIAVSANDPDALVPALKKATQRGIKVISWDSGVA 120 IYTGPTSTTAEGQIEVINSLIAQ VDAIAVSAND DALVPALKKA RGIKVISWDSGVA Sbjct: 61 IYTGPTSTTAEGQIEVINSLIAQKVDAIAVSANDTDALVPALKKAMDRGIKVISWDSGVA 120 Query: 121 PEGRILQLNPSSNELIGKMCLTLAKDHLEGGKGDFAILSATTTSTNQNIWIDQMKKQLKD 180 EGR++ LNPSS+ LIG M + LA D+L G GD A+LSA+ T+TNQN WI +MKK + Sbjct: 121 KEGRLMHLNPSSSPLIGNMIIKLAADNLPEG-GDVAVLSASATATNQNTWIAEMKKVQVN 179 Query: 181 FPGLNLVTTVYGDDLSDKSYREAEGLLKSNPNVKVIVAPTTVGVLAASKVVEDKGLVGKV 240 + G+N+V TVYGDDL+DKSYRE +GL++S+PN+K I+APT++G++AA++ V D G +G++ Sbjct: 180 YKGINVVATVYGDDLADKSYRETQGLIQSHPNLKAIIAPTSIGIVAAAQAVTDAGKIGQI 239 Query: 241 YVTGLGLPSEMAGAIKSGATKEFAIWNPIDLGYSATQIAYRLVKGETDGKPGSEINAGRM 300 VTGLGLPSEMAG +KSGA+K FAIWNPIDLGYSAT IAY ++ G + KPG+E+ GRM Sbjct: 240 NVTGLGLPSEMAGHVKSGASKSFAIWNPIDLGYSATMIAYDIING-AEAKPGAELKMGRM 298 Query: 301 GKIKVGDNGEAAMADPFVYNASNIDQFSKVF 331 G +K+ DN E AMADPFVY+ASN+++F+K+F Sbjct: 299 GTVKLDDNNEGAMADPFVYDASNVEEFAKIF 329 Lambda K H 0.313 0.131 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 329 Length adjustment: 28 Effective length of query: 303 Effective length of database: 301 Effective search space: 91203 Effective search space used: 91203 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory