Align sorbitol-6-phosphate dehydrogenase; EC 1.1.1.140 (characterized)
to candidate WP_015888055.1 NGR_RS09535 SDR family NAD(P)-dependent oxidoreductase
Query= CharProtDB::CH_091827 (259 letters) >NCBI__GCF_000018545.1:WP_015888055.1 Length = 251 Score = 106 bits (265), Expect = 4e-28 Identities = 81/251 (32%), Positives = 134/251 (53%), Gaps = 14/251 (5%) Query: 6 VVIGGGQTLGAFLCHGLAAEGYRVAVVDIQSDKAANVAQEINAEYGESMAYGFGADATSE 65 ++ GG +G + AEG V+VVDI + K ++V + +GE + + F AD + E Sbjct: 11 LLTGGVANIGLAIVEAFVAEGAIVSVVDIDAAKGSDVEKR----FGERVRF-FKADISQE 65 Query: 66 QSVL-ALSRGVDEIFGRVDLLVYSAGIAKAAFISDFQLGDFDRSLQVNLVGYFLCAREFS 124 + A+++ V + G +D L +AGI + + DF ++D+ +N+ F+ ARE S Sbjct: 66 DEIKNAIAQSVAWMKG-LDTLCLNAGIQLSGKMEDFSTSNWDKVFTINVRANFIFARE-S 123 Query: 125 RLMIRDGIQGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVHSLML 184 +RD + I+ ++S +GK G+ YSA+K +GLT +LAL+LA GI V+++ Sbjct: 124 VKHLRDAGKASIVMMSSLAGKRGAPGLLAYSASKAAVIGLTTTLALELARDGIRVNAVCP 183 Query: 185 GNLLKSPMFQSLLPQYATKLGIKPDQVEQYYIDKVPLKRGCDYQDVLNMLLFYASPKASY 244 G + +P Q + + D+ E +PL R Q+V + ++ AS +ASY Sbjct: 184 G-WIDTPFNQPAIDYLGGR-----DKQESLVPTVIPLGRQATPQEVAPLFVYLASDEASY 237 Query: 245 CTGQSINVTGG 255 T QSINV GG Sbjct: 238 VTAQSINVDGG 248 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 251 Length adjustment: 24 Effective length of query: 235 Effective length of database: 227 Effective search space: 53345 Effective search space used: 53345 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory