Align ABC transporter for D-Trehalose, permease component 1 (characterized)
to candidate WP_015888370.1 NGR_RS11135 sugar ABC transporter permease
Query= reanno::Smeli:SM_b20326 (328 letters) >NCBI__GCF_000018545.1:WP_015888370.1 Length = 328 Score = 592 bits (1526), Expect = e-174 Identities = 291/328 (88%), Positives = 312/328 (95%) Query: 1 MTDLSLADRPAALAHGGRIGSDLQAQRVRSAWLFLAPTFLVLALVAGWPLIRTIYFSFTN 60 MTDL++AD AALAH I SDL+AQRVRSAW+FLAPT LVLALVAGWPL+RTIYFSFT+ Sbjct: 1 MTDLTVADPRAALAHPSHINSDLRAQRVRSAWVFLAPTLLVLALVAGWPLVRTIYFSFTD 60 Query: 61 ASLTNLSGAEFVGFANYLSWITLKSGRTIYRGLLADPAWWNAVWNTLKFTVLSVSIETAL 120 ASLTNL+GAEFVGF NYLSWITLKSGRTIY+GLLADPAWWNAVWNTLKFTV+SVSIETAL Sbjct: 61 ASLTNLAGAEFVGFQNYLSWITLKSGRTIYKGLLADPAWWNAVWNTLKFTVISVSIETAL 120 Query: 121 GLIVALVLNAQFPGRGLVRAAILIPWAIPTIVSAKMWAWMLNDQFGILNDMLIGLGLIGE 180 GL+VALVLNA FPGRGLVRAAILIPWAIPTIVSAKMWAWMLNDQFGILN++ +GLGLI + Sbjct: 121 GLVVALVLNAHFPGRGLVRAAILIPWAIPTIVSAKMWAWMLNDQFGILNEIFVGLGLISQ 180 Query: 181 KIAWTASPDTAMIAELIVDVWKTTPFMALLILAGLQMVPGDIYEAAKIDGVHPVRVFWRV 240 KIAWTASPDTAM+A LIVDVWKTTPFMALLILAGLQMVP DIYEAAKIDG+HP+RVFWRV Sbjct: 181 KIAWTASPDTAMVAVLIVDVWKTTPFMALLILAGLQMVPVDIYEAAKIDGIHPLRVFWRV 240 Query: 241 TLPLIRPALMVAVIFRMLDALRIFDLIYVLTPNNAQTKTMSVMARENLFDFDKFAYGAAA 300 TLPLIRPALMVAVIFRMLDALRIFDLIYVLTPNNAQTKTMSV+ARENLFDFDKFAYGAAA Sbjct: 241 TLPLIRPALMVAVIFRMLDALRIFDLIYVLTPNNAQTKTMSVLARENLFDFDKFAYGAAA 300 Query: 301 STMLFLIIATITILYMWLGRLNLSGGER 328 STMLFLIIA+IT+LYMW GR+N GGER Sbjct: 301 STMLFLIIASITVLYMWFGRVNFEGGER 328 Lambda K H 0.328 0.140 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 571 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 328 Length adjustment: 28 Effective length of query: 300 Effective length of database: 300 Effective search space: 90000 Effective search space used: 90000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory