Align 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase; 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; HHED aldolase; 4-hydroxy-2-ketoheptane-1,7-dioate aldolase; HKHD aldolase; EC 4.1.2.52 (characterized)
to candidate WP_015886713.1 NGR_RS02860 4-hydroxy-2-oxoheptanedioate aldolase
Query= SwissProt::Q47098 (262 letters) >NCBI__GCF_000018545.1:WP_015886713.1 Length = 257 Score = 291 bits (746), Expect = 7e-84 Identities = 149/251 (59%), Positives = 185/251 (73%), Gaps = 1/251 (0%) Query: 3 NSFKAALKAGRPQIGLWLGLSSSYSAELLAGAGFDWLLIDGEHAPNNVQTVLTQLQAIAP 62 N FK L AG+ QIGLW GL SY+AE++A +GFDWLL D EH+P +V TVL QLQA+A Sbjct: 6 NRFKQKLLAGQSQIGLWCGLPGSYAAEIVALSGFDWLLFDTEHSPGDVLTVLPQLQAVAS 65 Query: 63 YPSQPVVRPSWNDPVQIKQLLDVGTQTLLVPMVQNADEAREAVRATRYPPAGIRGVGSAL 122 Y PVVRP+ NDPV IK+ LD+G QTLLVP VQNA+EA+ AV A RYPP GIRGV SAL Sbjct: 66 YDVSPVVRPAINDPVLIKRFLDIGVQTLLVPYVQNAEEAKAAVAAVRYPPDGIRGV-SAL 124 Query: 123 ARASRWNRIPDYLQKANDQMCVLVQIETREAMKNLPQILDVEGVDGVFIGPADLSADMGY 182 RA+R+ R+ +Y Q A ++C+L+Q+ETREA+ NL I VEGVDGVF+GPADL+A G+ Sbjct: 125 TRATRFGRVANYAQNAEREICLLLQVETREALGNLEPIASVEGVDGVFVGPADLAASFGH 184 Query: 183 AGNPQHPEVQAAIEQAIVQIRESGKAPGILIANEQLAKRYLELGALFVAVGVDTTLLARA 242 G P HPEV AI AI +++ GK GIL +E+ A R + +G LF AVGVD +LAR Sbjct: 185 RGQPSHPEVVDAIVDAIERLKALGKPAGILTPDEKFAARCIAMGTLFTAVGVDVAVLARG 244 Query: 243 AEALAARFGAQ 253 +EALAARF +Q Sbjct: 245 SEALAARFASQ 255 Lambda K H 0.317 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 257 Length adjustment: 24 Effective length of query: 238 Effective length of database: 233 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory