Align 4-hydroxy-2-oxovalerate aldolase; HOA; EC 4.1.3.39 (uncharacterized)
to candidate WP_015888315.1 NGR_RS10855 aldolase/citrate lyase family protein
Query= curated2:O86013 (262 letters) >NCBI__GCF_000018545.1:WP_015888315.1 Length = 273 Score = 168 bits (426), Expect = 1e-46 Identities = 103/234 (44%), Positives = 134/234 (57%), Gaps = 3/234 (1%) Query: 6 NSFKAALREGPVQLGFWLALAHPDIAEICAGQGYDWLLIDGEHGPQTLPGIVAQLRAVEA 65 N KA L G V G W+ P AEI G+D+LL+D EHG I+ LRA+E Sbjct: 5 NRLKAHLAAGHVAFGCWVGGGSPTNAEILGHAGFDFLLVDHEHGVGETSEIIDTLRAIET 64 Query: 66 TPPCSAIVRVPGHDSVTIKQVLDLGAQTLMVPMVETAEQAKAIVTASRYPPAGERGL--G 123 TP A+VRVP +D V +K+VLD G Q++M+P V+TAE A A V A RYPP G RG G Sbjct: 65 TPS-PALVRVPWNDHVFLKRVLDAGVQSVMIPSVDTAEAALAAVRACRYPPDGIRGYAAG 123 Query: 124 GARASRWGGYPAYVAEANAQVCIIAQIETATAVDNIEAIAAVDGIDALFLGPADLAATEG 183 RAS +G P Y+ +AN + I QIE+ TAVDN EAIAA +G D +F+G DLA + G Sbjct: 124 VVRASTFGLEPGYIHKANENMLIAVQIESFTAVDNAEAIAATEGADIIFIGVNDLAGSIG 183 Query: 184 LLGASSFDALFKLTGEALARIVATGKPAGILSRDERLVQQFLDGGARFIANGID 237 L + + +L A I+A+GK G + V + +D G R IA D Sbjct: 184 RLEQTGHPEVRELVQRAEKAILASGKIMGTVPNAGASVAELIDRGYRVIAGPHD 237 Lambda K H 0.320 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 273 Length adjustment: 25 Effective length of query: 237 Effective length of database: 248 Effective search space: 58776 Effective search space used: 58776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory