Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_012709123.1 NGR_RS24180 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase PaaG
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_000018545.1:WP_012709123.1 Length = 263 Score = 142 bits (358), Expect = 7e-39 Identities = 87/261 (33%), Positives = 130/261 (49%), Gaps = 3/261 (1%) Query: 2 EFETIETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAF 61 E ET+ + E + +TLNRPDKLNA N + L +A SD +R +++TG G+ F Sbjct: 3 ESETVLSALEDGVLRLTLNRPDKLNAFNEAMHVALRAGFERAHSDDHVRAVLLTGAGRGF 62 Query: 62 CAGADITQFNQL---TPAEAWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALAC 118 AG D+ + TP ++ I L KP + +NG A G G +A AC Sbjct: 63 SAGQDLGDRDPRKGGTPDLGQTIETFYNPLLRLIRNLEKPVVCAVNGVAAGAGANIAFAC 122 Query: 119 DIRIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLV 178 DI +AA A+ +G+ P GGT L+R+IG+ RA + +T + + + A +GL+ Sbjct: 123 DITLAARSARFIQAFAKIGLVPDSGGTWSLSRLIGEARAKALALTAEPLDAETAASWGLI 182 Query: 179 NRVVPLANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFST 238 R + A L E LA ++A + L K + ++ L LE + Sbjct: 183 WRAIDDAALLDEATALAARLAAGPTKGIGLTKRAIQAAANNAFDEQLDLERDLQREAGRS 242 Query: 239 EDKKEGVSAFLEKREPTFKGK 259 D EGV+AFLEKR+P FKG+ Sbjct: 243 ADYAEGVAAFLEKRKPEFKGR 263 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 263 Length adjustment: 25 Effective length of query: 234 Effective length of database: 238 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory