Align FAA hydrolase family protein (characterized, see rationale)
to candidate WP_012706479.1 NGR_RS02045 fumarylacetoacetate hydrolase family protein
Query= uniprot:A0A2E7P912 (281 letters) >NCBI__GCF_000018545.1:WP_012706479.1 Length = 291 Score = 159 bits (403), Expect = 5e-44 Identities = 85/211 (40%), Positives = 123/211 (58%), Gaps = 3/211 (1%) Query: 71 GKFICIGLNYADHAAESNLPIPAEPVVFNKWTSAVVGPNDDVKIPRGSKKTDWEVELGVV 130 GK +C+GLNYADH ES P P +F ++TS+++ + + P S+ D+E EL V Sbjct: 75 GKIVCVGLNYADHTEESGYKQPDHPTLFPRFTSSLIAAGEPIVRPFVSETLDFEGELVAV 134 Query: 131 IGKGGSYIDEKDAMSHVAGYCVVNDVSEREYQIERGGTWDKGKGCDTFGPIGPWLVTRDE 190 IG+ G +I + DA+ HVAGY + ND S RE+Q R W GK D G GPW VT DE Sbjct: 135 IGRRGRHISKHDALDHVAGYSIFNDASIREFQ-HRTPQWTLGKNFDGTGSFGPWFVTADE 193 Query: 191 V-ADPQKLGMWLEVDGKRYQNGNTSTMIFGVAHIVSYLSRFMSLQPGDVISTGTPPGVGM 249 + L + ++G+ Q NT +IF VA +VS +S ++L+PGD+I TGTP G+G Sbjct: 194 LPRGAAGLRIETRLNGEVVQASNTDQLIFDVATLVSTISEAITLEPGDLIVTGTPSGIGH 253 Query: 250 GVKPEAVYLRAGQTMRLGIDGLGEQQQKTID 280 P +Y+RAG + + I +G + +D Sbjct: 254 ARNPR-LYMRAGDVVEVEIQSIGTLRNPVVD 283 Lambda K H 0.316 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 291 Length adjustment: 26 Effective length of query: 255 Effective length of database: 265 Effective search space: 67575 Effective search space used: 67575 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory