Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_015887685.1 NGR_RS07685 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_000018545.1:WP_015887685.1 Length = 366 Score = 378 bits (971), Expect = e-109 Identities = 201/369 (54%), Positives = 265/369 (71%), Gaps = 12/369 (3%) Query: 1 MATLELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGG 60 M+TLE+ V KTYG + LK + +SI G+FL+L+GPSGCGKSTL+N IAGLE I+GG Sbjct: 1 MSTLEIDRVRKTYGN--LEVLKEVSISIGTGDFLVLLGPSGCGKSTLLNMIAGLENISGG 58 Query: 61 AIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVA 120 + I + V+ +SPKDRDIAMVFQSYALYPTM+VR+NIEFG+KIR +P A + V A Sbjct: 59 EVRIAGKVVNELSPKDRDIAMVFQSYALYPTMTVRQNIEFGMKIRGIPPAHREKAVRAAA 118 Query: 121 KLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 LLQI HLL+RKP QLSGGQ+QRVAMGRA+ R+PK++LFDEPLSNLDAKLRV+MRTE+K Sbjct: 119 DLLQITHLLDRKPSQLSGGQRQRVAMGRAIVRQPKLFLFDEPLSNLDAKLRVDMRTEIKR 178 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGSPP 240 +H RL TT VYVTHDQIEAMTL +VAVMK G++QQ P+ +Y+ PAN +VA F+GSP Sbjct: 179 LHARLGTTIVYVTHDQIEAMTLATRVAVMKGGVVQQLDEPQTVYDRPANVYVARFVGSPS 238 Query: 241 MNFVPLRLQRKDGRLVALLDSGQARCE----LALNTTEAG-LEDRDVILGLRPEQIMLAA 295 MN +P +++ + G L A++D + + L++ A +R V++G+RPE M + Sbjct: 239 MNIIPGKVEIEGGALTAVIDVANRQAARIPGITLSSQAASKYANRKVLVGIRPE--MFSV 296 Query: 296 GEGDSASSIRAEVQVTEPTGPDTLVFVQLNDTKVCCRLAP-DVAPQVGETLTLQFDPSKV 354 G G + ++ +V V EPTGPDTL QL +V RL P V+ + TL++ D SKV Sbjct: 297 GNGQTQGAVSVDVDVVEPTGPDTLAVFQLGGVEVTARLPPRQVSARTPATLSV--DTSKV 354 Query: 355 LLFDANTGE 363 +LFD ++ E Sbjct: 355 VLFDPDSEE 363 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 366 Length adjustment: 30 Effective length of query: 356 Effective length of database: 336 Effective search space: 119616 Effective search space used: 119616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory