Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_015888093.1 NGR_RS09720 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_000018545.1:WP_015888093.1 Length = 355 Score = 355 bits (910), Expect = e-102 Identities = 190/365 (52%), Positives = 246/365 (67%), Gaps = 12/365 (3%) Query: 1 MATLELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGG 60 MA ++ +V K++GA +K + + I +GEF+ILVGPSGCGKSTL+ +AGLE IT G Sbjct: 1 MAGVDFVDVRKSFGA--VPIIKGVNIEIDDGEFVILVGPSGCGKSTLLRMLAGLENITAG 58 Query: 61 AIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVA 120 I IGD+ V+ + PKDRDIAMVFQ+YALYP M+V +N+ F L + P+A+ID V A Sbjct: 59 EIRIGDRVVNRLPPKDRDIAMVFQNYALYPHMTVADNMAFSLMLASTPKAEIDKRVGVAA 118 Query: 121 KLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 ++L + LL+R P QLSGGQ+QRVAMGRA+ R P+++LFDEPLSNLDAKLRV MR E+K Sbjct: 119 EILGLSKLLDRYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVAMRAEIKE 178 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGSPP 240 +HQRLKTTTVYVTHDQIEAMT+ DK+ VM DGI++Q G P E+Y++PAN FVA FIGSP Sbjct: 179 LHQRLKTTTVYVTHDQIEAMTMADKIVVMHDGIVEQIGAPLELYDHPANLFVAGFIGSPA 238 Query: 241 MNFVPLRLQRKDGRLVALLDSGQARCELALNTTEAGLEDRDVILGLRPEQIMLAAGEGDS 300 MN + RL +D D L + A RD++ GLRPE + L Sbjct: 239 MNMIRGRLHPEDPTAFMTADG----TALPVARPSAAARGRDLVYGLRPEYMSL------D 288 Query: 301 ASSIRAEVQVTEPTGPDTLVFVQLNDTKVCCRLAPDVAPQVGETLTLQFDPSKVLLFDAN 360 + + AEV VTEPTG +T + +L V C V + GET+ L+ D + V LFDA Sbjct: 289 PNGLPAEVVVTEPTGYETQMIARLGGNDVTCVFRERVTAKPGETIRLKIDGAHVHLFDAE 348 Query: 361 TGERL 365 TG+RL Sbjct: 349 TGQRL 353 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 355 Length adjustment: 30 Effective length of query: 356 Effective length of database: 325 Effective search space: 115700 Effective search space used: 115700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory