Align Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized)
to candidate WP_012411414.1 NPUN_RS25940 ABC transporter ATP-binding protein
Query= TCDB::P0AAG3 (241 letters) >NCBI__GCF_000020025.1:WP_012411414.1 Length = 254 Score = 144 bits (364), Expect = 1e-39 Identities = 88/224 (39%), Positives = 130/224 (58%), Gaps = 8/224 (3%) Query: 1 MITLKNVSKWYG----HFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQQG 56 +I L+N+ K YG + L D + V++GE + GPSGSGKST + + L+ G Sbjct: 21 IIRLENIFKIYGSGETEVRALNDVNLIVEQGEYCAIMGPSGSGKSTAMNIIGCLDRPTTG 80 Query: 57 EITVDGI-VVNDKKTDLAKLRSR-VGMVFQHFELFPHLSIIENLTLAQVKVLKRDKAPAR 114 +D + V LA +R++ +G VFQ F L P L+ +EN+ L + K + Sbjct: 81 HYYLDNLDVAQMDDRSLAHIRNKKLGFVFQQFHLLPQLTALENVILPMLYAGVNPKERS- 139 Query: 115 EKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINE 174 ++A+ L RVGL+ N P QLSGGQQQRVAIARA+ P+ +L DEPT ALD E Sbjct: 140 DRAIVALTRVGLANRLNNKPTQLSGGQQQRVAIARAIVNRPVVLLADEPTGALDSRTTQE 199 Query: 175 VLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDS 218 VLD+ EL G+T+++VTHE AR+ R+++ +G++V + Sbjct: 200 VLDIFSELNASGITVVMVTHEPEVARQ-TQRIVWFRDGQVVHSN 242 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 254 Length adjustment: 24 Effective length of query: 217 Effective length of database: 230 Effective search space: 49910 Effective search space used: 49910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory