Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_012407398.1 NPUN_RS03135 SDR family oxidoreductase
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_000020025.1:WP_012407398.1 Length = 262 Score = 132 bits (331), Expect = 1e-35 Identities = 89/251 (35%), Positives = 133/251 (52%), Gaps = 7/251 (2%) Query: 12 GLRVLISGGAAGIGEVLAAAYLEAGAQVHVCDVSES----ALAVFRDKYPGTVATRADVS 67 G LI+ + G+G+ A + GA+V +C SES A + + ++ RADV+ Sbjct: 7 GKVALITAASKGLGKATARQFAREGAKVAICARSESIDTTAAEIASETGTEVLSLRADVT 66 Query: 68 DAAQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHH 127 A IE V E GGLD+LV NAG P G D I A W+ +IN+ L + R Sbjct: 67 SQADIERVINTTVERFGGLDILVTNAG-GPPAGTFDDIDLATWETSINLTLLSAVRLVKF 125 Query: 128 AVPMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALL 187 A+P L++S+ +L I S + + + + A++GL K+L+ ELG IRVN++L Sbjct: 126 ALPHLRQSTTPAILTITSTSTKQPVENLVLSNSIRLAVIGLTKTLSQELGSDKIRVNSIL 185 Query: 188 PGIVEGPRMDGVIRARAEQVG-VPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAAR 246 PG R++ +I AR + G EAE+ + + L R+ T E+ A +A+FL SPAA Sbjct: 186 PGWTYTERVEELINARIAKSGETKEAEIARVSAT-VPLGRIGTPEEFANVAVFLSSPAAS 244 Query: 247 NVTGQAISVDG 257 V G + VDG Sbjct: 245 FVNGVMLEVDG 255 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 8 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 262 Length adjustment: 25 Effective length of query: 237 Effective length of database: 237 Effective search space: 56169 Effective search space used: 56169 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory