Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate WP_012412538.1 NPUN_RS32120 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >NCBI__GCF_000020025.1:WP_012412538.1 Length = 244 Score = 208 bits (529), Expect = 1e-58 Identities = 113/241 (46%), Positives = 156/241 (64%), Gaps = 10/241 (4%) Query: 21 LHKQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQILLDGESIG 80 L K +G L+VLK + +G VV ++G SGSGK+T LRC+N+LE+ G+I + I Sbjct: 11 LCKSFGKLDVLKDISTEFYQGEVVAILGPSGSGKSTFLRCINLLEQPTRGRIYFHEQEIT 70 Query: 81 YHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLHKDEAVVL 140 + N IA+ R M FQ FNLFPH+ L+NVT +KVK ++K +A Sbjct: 71 KPKTN----------IAKVRQYLVMVFQHFNLFPHMNVLENVTYAPIKVKGINKQKAQEH 120 Query: 141 AEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDPELVGEVL 200 + L +VGL + + YP +LSGGQ+QRVAIARA+AM P ++LFDE TSALDPE+V +VL Sbjct: 121 GLELLAKVGLESKANVYPSKLSGGQKQRVAIARALAMEPEMILFDEPTSALDPEMVKDVL 180 Query: 201 SVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQSPRLAEFL 260 V+K LA GMTM +VTHEM FA V+++I+F++QG + E P E F+ PQ R +FL Sbjct: 181 EVMKDLALSGMTMAIVTHEMGFARVVANRIMFLDQGILAEDTTPGEFFQNPQCDRAKQFL 240 Query: 261 K 261 + Sbjct: 241 E 241 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 244 Length adjustment: 24 Effective length of query: 241 Effective length of database: 220 Effective search space: 53020 Effective search space used: 53020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory