Align ABC transporter for Lactose, permease component 2 (characterized)
to candidate WP_012409870.1 NPUN_RS17650 carbohydrate ABC transporter permease
Query= reanno::Smeli:SM_b21654 (272 letters) >NCBI__GCF_000020025.1:WP_012409870.1 Length = 278 Score = 157 bits (397), Expect = 2e-43 Identities = 82/260 (31%), Positives = 143/260 (55%), Gaps = 3/260 (1%) Query: 14 YGFLGLMAFLSVFPFIWMVLGATNSSIDII---KGKLLPGAAFATNVANFFTLVNVPLVF 70 Y LG +A + +FP +W++ A S + I +LLP N + + + Sbjct: 15 YALLGAIALVMLFPLLWLISTALKSPTENILQSPPQLLPSQPTLDNFFSVWNSLPFGQYL 74 Query: 71 WNSAKIAIVATVLTLAVSSLAGYGFEMFRSRRRERVYRAMLLTLMIPFAALMIPLFVMMG 130 +NS ++++ L L +LA Y R+ ++ A++ T+MIPF +MIPL+++ Sbjct: 75 YNSTLVSVLTVGLNLLFCALAAYPLARLSFVGRDWIFVAIVSTIMIPFQIVMIPLYILTV 134 Query: 131 KAGLINTHLAVVLPSIGSAFVIFYFRQSTKAFPSELRDAAKVDGLKEWQIFLFIYVPVMR 190 + GL N++L ++ PS+ SAF IF RQ+ + P E+ +AA++DG E ++ + +P +R Sbjct: 135 QLGLRNSYLGMIFPSLASAFGIFLLRQAFMSVPKEIEEAARMDGSSELGLWWHVMLPAVR 194 Query: 191 STYAAAFVIVFMTAWNNYLWPLIVLQTNETKTITLVISSLASAYYPDYGVVMVGTILATL 250 + VF+ AW+++LWPLIV+Q T+ L ++ LA + D+ +V G+++A Sbjct: 195 PALVTLAIFVFIGAWSDFLWPLIVIQDENLYTLPLGVAKLAGTFSLDWRLVAAGSVIAIA 254 Query: 251 PTLAVFFFMQRQFVQGMLGS 270 P L +F F+QR V GS Sbjct: 255 PVLLLFLFLQRYIVPTDTGS 274 Lambda K H 0.331 0.141 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 278 Length adjustment: 25 Effective length of query: 247 Effective length of database: 253 Effective search space: 62491 Effective search space used: 62491 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory