Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate WP_012409520.1 NPUN_RS15405 ABC transporter ATP-binding protein
Query= uniprot:Q88GX0 (260 letters) >NCBI__GCF_000020025.1:WP_012409520.1 Length = 252 Score = 157 bits (396), Expect = 3e-43 Identities = 93/229 (40%), Positives = 136/229 (59%), Gaps = 8/229 (3%) Query: 12 PEPDPRPVLIRIEGLNKHYGA----FHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCIN 67 P P P+ +I +E + K YG+ L DI+L V +GE + G SGSGKST + I Sbjct: 13 PSPTPQSAIIYLEKVFKVYGSGETKVQALNDINLIVEQGEYCAIMGSSGSGKSTAMNIIG 72 Query: 68 RLEVAQQGSIQVDGIDLAATTR-EAAQVRSD-IGMVFQHFNLFPHMSVLDNCLLAPTSVR 125 L+ G ++ +D+A T E A +R+ +G VFQ F+L +S L+N +L P Sbjct: 73 CLDRPSCGHYYLNHLDVAQMTDVELANIRNQKLGFVFQQFHLLTQLSALENVML-PMVYA 131 Query: 126 GLSRKDAEERARMYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSA 185 G+ ++ ERA L +VG+ ++ + P+QLSGGQQQRVAIARA+ P I+L DEPT A Sbjct: 132 GVQLEERRERAIRALQRVGLANRLYNKPTQLSGGQQQRVAIARAIVNCPAILLADEPTGA 191 Query: 186 LDPEMVAEVLDVLVQLAGTGMTMLCVTHEMGFARQVAERVLFLEGGQII 234 LD EVLD+ +L +G+T++ VTHE ARQ R+++ GQ++ Sbjct: 192 LDSRTTQEVLDIFTELNNSGITVMMVTHESDVARQ-TRRIIWFRDGQVV 239 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 252 Length adjustment: 24 Effective length of query: 236 Effective length of database: 228 Effective search space: 53808 Effective search space used: 53808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory