Align Polyphosphate glucokinase; EC 2.7.1.63; ATP-dependent glucokinase; EC 2.7.1.2; Polyphosphate--glucose phosphotransferase (uncharacterized)
to candidate WP_012408550.1 NPUN_RS09515 ROK family protein
Query= curated2:Q49988 (324 letters) >NCBI__GCF_000020025.1:WP_012408550.1 Length = 238 Score = 114 bits (285), Expect = 2e-30 Identities = 76/233 (32%), Positives = 119/233 (51%), Gaps = 11/233 (4%) Query: 78 RGFGIDIGGSSIKGGIVDLDIGQLIGDRIKLLTPQPATPLAVAKTIAEVVNAFGWTAPLG 137 R +DIGGS +K ++D+ G + +R +L TPQPATP V I + A G + Sbjct: 9 RTLSVDIGGSGVKAMVLDIT-GSPVTERARLDTPQPATPGVVINAIVVLAAAQGEFHRVS 67 Query: 138 VTYPGVVTQGVVRTAANVDDSWIGTNARDIISAELNSQEVTILNDADAAGLAEGRYGAGK 197 V +PGVV GV TA N+ WIG + + LN + V ++NDAD G AGK Sbjct: 68 VGFPGVVRCGVTETAVNLHPDWIGFDLETALLKHLN-KPVRVINDADMQGFGA---IAGK 123 Query: 198 NNSGLIVLLTFGTGIGSAVIHNGKLIPNTEFGHLEV-DGKEAEQRAASSVKDKYKWSYRT 256 G+ +++T GTG GSA+ +GKL+PN E GH G+ EQ+ + +K + Sbjct: 124 ---GVELVITLGTGFGSALFVDGKLVPNMEMGHHPFRKGETFEQQLGRAELEKI--GEKR 178 Query: 257 WAKQVTRVLVAIENAMCPDLFIAGGGISRKADRWIPLLENRTPMVAAALQNTA 309 W +++ + + ++++ D GGG + + + +PL P + L A Sbjct: 179 WNRRLEKAIASLQHLFNYDYLYIGGGEAVRVNFQLPLNVKLIPNITGLLGGIA 231 Lambda K H 0.316 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 238 Length adjustment: 25 Effective length of query: 299 Effective length of database: 213 Effective search space: 63687 Effective search space used: 63687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory