Align ABC-type Maltose/ Maltodextrin permease (characterized, see rationale)
to candidate WP_012409870.1 NPUN_RS17650 carbohydrate ABC transporter permease
Query= uniprot:Q6MNM1 (272 letters) >NCBI__GCF_000020025.1:WP_012409870.1 Length = 278 Score = 164 bits (414), Expect = 3e-45 Identities = 88/260 (33%), Positives = 158/260 (60%), Gaps = 5/260 (1%) Query: 15 SLFSIYPILYVLSVSLRP--DNAFQTQSLEIIGPNASFKNFVDLFATTDFLIWMRNSLVV 72 +L ++P+L+++S +L+ +N Q+ +++ + NF ++ + F ++ NS +V Sbjct: 22 ALVMLFPLLWLISTALKSPTENILQSPP-QLLPSQPTLDNFFSVWNSLPFGQYLYNSTLV 80 Query: 73 SAATTLLGVALASTSAYALARYRFRGRNMMLFSLLMTQMFPATMLMLPFYIILSKLRLID 132 S T L + + +AY LAR F GR+ + +++ T M P ++M+P YI+ +L L + Sbjct: 81 SVLTVGLNLLFCALAAYPLARLSFVGRDWIFVAIVSTIMIPFQIVMIPLYILTVQLGLRN 140 Query: 133 SFWGLFLIYSSTALPFCIWQMKAYYDTIPRELEEAALLDGCSKWMIFYKIILPVSSPALV 192 S+ G+ I+ S A F I+ ++ + ++P+E+EEAA +DG S+ +++ ++LP PALV Sbjct: 141 SYLGM--IFPSLASAFGIFLLRQAFMSVPKEIEEAARMDGSSELGLWWHVMLPAVRPALV 198 Query: 193 ITALFSFMSSWSEYVIAAVVLQDPQLYTLPLGLRSFQASLATQWGLYAAGALIVSVPVLI 252 A+F F+ +WS+++ +V+QD LYTLPLG+ + + W L AAG++I PVL+ Sbjct: 199 TLAIFVFIGAWSDFLWPLIVIQDENLYTLPLGVAKLAGTFSLDWRLVAAGSVIAIAPVLL 258 Query: 253 LFISISRYLVSGLTMGSVKG 272 LF+ + RY+V T VKG Sbjct: 259 LFLFLQRYIVPTDTGSGVKG 278 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 278 Length adjustment: 25 Effective length of query: 247 Effective length of database: 253 Effective search space: 62491 Effective search space used: 62491 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory