Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate WP_012409318.1 NPUN_RS14210 carbohydrate ABC transporter permease
Query= reanno::Dino:3607127 (272 letters) >NCBI__GCF_000020025.1:WP_012409318.1 Length = 275 Score = 123 bits (308), Expect = 5e-33 Identities = 91/263 (34%), Positives = 137/263 (52%), Gaps = 15/263 (5%) Query: 13 LLVLIITVCVFPFYWMVTTSLK--TQIVALEAPPVWIFEPTLSNYREALFEDGVL-RTLI 69 LL L V + PF W ++ S K T+IV E P TL NYR+ ++ + R L Sbjct: 14 LLTLYAIVTLIPFLWALSASFKPLTEIVGGE-PNFLPKNFTLDNYRQIFLQEPLFWRWLF 72 Query: 70 NSLIIAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLAL-PFFLIAR 128 NS++IA+S T L L+L A +ALAR F GK+ WF+ I + P + L P FLI + Sbjct: 73 NSVVIAVSVTLLNLLLNSMAGYALARLRFVGKR-FWFFLILAVLAVPAQITLIPTFLILK 131 Query: 129 NLGLLDKHITLI---LIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKIC 185 +G L+ + +I ++ TF I+++ F P +L+EAA+L+G + F I R I Sbjct: 132 AIGWLNSYQGMIVPSMVNATF-----IFMMRQFFVNFPKELEEAAQLDGLNTFGIFRHIV 186 Query: 186 LPLAMPGVAVSAIFSFIFSWNELMFGL-ILTRSEAKTAPAMAVSFMEGYNLPYGKIMATS 244 LPLA P +A A+F F+ SWN + + IL E T P +F Y + IMA S Sbjct: 187 LPLAKPALAAQAVFVFMGSWNNFLLPIVILFDPEMFTLPLGLNTFKGQYISYWNYIMAAS 246 Query: 245 TLIVIPVLIFALIASKQLVRGLT 267 + +P L ++ ++ +T Sbjct: 247 MVFTLPALGIYAFFNRYFIQSVT 269 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 275 Length adjustment: 25 Effective length of query: 247 Effective length of database: 250 Effective search space: 61750 Effective search space used: 61750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory