Align AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate WP_012404721.1 BPHY_RS27410 amino acid ABC transporter permease
Query= TCDB::Q52814 (384 letters) >NCBI__GCF_000020045.1:WP_012404721.1 Length = 219 Score = 110 bits (276), Expect = 3e-29 Identities = 67/211 (31%), Positives = 110/211 (52%), Gaps = 8/211 (3%) Query: 174 GLMVTLVLSFVGIAVSLPVGILLALGRRSRMPVIRMLCVTFIEVIRGVPLITVLFMASVM 233 G MVTL + + L VG ++A+ S P+I + ++ ++RG PL+ +F+ Sbjct: 17 GAMVTLKFALASAVLGLLVGFIVAIMGISGQPIIAGIARAYVSLMRGTPLLVQIFVVYYG 76 Query: 234 LPLFLPTGWNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKTR 293 LP G ++D ++ ++ AY++E +RG + I +GQ+ A SLGL + Q R Sbjct: 77 LP---DLGISLDPTSAGILALTANAGAYLSESMRGAILGISQGQWGAAHSLGLTHMQTLR 133 Query: 294 LIIMPQAIKLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGIVKLNFSDANWASAVTPITGL 353 +I PQA+++ +PS+ NT I KDTSLV++I + ++ L + AS P+ Sbjct: 134 YVICPQALRMAVPSLGNTLISLIKDTSLVSVITVTEM-----LRAAQEVIASTFQPLPLY 188 Query: 354 IFAGFIFWLFCFGMSRYSGFMERHLDTGHKR 384 + A I+WL GMS +E L H R Sbjct: 189 LAAAAIYWLLSTGMSWVQRHVEVRLARAHVR 219 Lambda K H 0.330 0.145 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 219 Length adjustment: 26 Effective length of query: 358 Effective length of database: 193 Effective search space: 69094 Effective search space used: 69094 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory