Align glutamate-aspartate periplasmic-binding protein (characterized)
to candidate WP_012403987.1 BPHY_RS23655 glutamate/aspartate ABC transporter substrate-binding protein
Query= CharProtDB::CH_002441 (302 letters) >NCBI__GCF_000020045.1:WP_012403987.1 Length = 299 Score = 322 bits (826), Expect = 5e-93 Identities = 163/294 (55%), Positives = 209/294 (71%), Gaps = 4/294 (1%) Query: 9 AILALALSAGLAQADDAAPAAGSTLDKIAKNGVIVVGHRESSVPFSYYDNQQKVVGYSQD 68 A +A A++ G A A + + +TL KI + G I +G RESSVPFSYYD QQ V+GYSQ Sbjct: 10 AFVAWAVAVGNACAQEPS----ATLKKIRETGAISLGVRESSVPFSYYDEQQHVIGYSQA 65 Query: 69 YSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAAFSD 128 + IV+ VKK+LN PDL+V+ IPITSQNRIPL+QNGT D ECGSTT+ ER Q AFS+ Sbjct: 66 IALKIVDEVKKELNLPDLKVREIPITSQNRIPLVQNGTIDIECGSTTHTKERDNQVAFSN 125 Query: 129 TIFVVGTRLLTKKGGDIKDFANLKDKAVVVTSGTTSEVLLNKLNEEQKMNMRIISAKDHG 188 + F G R++ KK +KDF +L +K VV T+GT+ E LL ++N E+ MNMR+ISAKDH Sbjct: 126 SFFQYGVRMIVKKESGVKDFGDLANKTVVTTAGTSEERLLRQMNAEKSMNMRLISAKDHA 185 Query: 189 DSFRTLESGRAVAFMMDDALLAGERAKAKKPDNWEIVGKPQSQEAYGCMLRKDDPQFKKL 248 +SF +++GRAVAF+MDD LL G +AK D + I G E YGCM RKDDP FK+L Sbjct: 186 ESFLNVKTGRAVAFVMDDPLLYGAKAKEANADEYLITGTSPMSEVYGCMFRKDDPGFKRL 245 Query: 249 MDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNMNFELSDEMKALFKEPNDKALN 302 D IA++QTSGEA + KWF PIPPK +N+N+ LS EMK LF +PND+AL+ Sbjct: 246 TDGVIARLQTSGEAANLYQKWFTQPIPPKGINLNYPLSAEMKQLFAKPNDRALD 299 Lambda K H 0.314 0.130 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 299 Length adjustment: 27 Effective length of query: 275 Effective length of database: 272 Effective search space: 74800 Effective search space used: 74800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory