Align ATPase (characterized, see rationale)
to candidate WP_012403839.1 BPHY_RS22905 amino acid ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_000020045.1:WP_012403839.1 Length = 299 Score = 250 bits (638), Expect = 3e-71 Identities = 135/255 (52%), Positives = 175/255 (68%), Gaps = 9/255 (3%) Query: 13 AIASAPETMIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALE 72 A+ S ET++ G+ K +G + L VSLTV +GE V ++GPSG GKST LR +N LE Sbjct: 28 AVRSGSETVLQLNGISKSFGEN-KVLRDVSLTVHKGETVCLLGPSGCGKSTLLRCVNWLE 86 Query: 73 SHQRGEIWI--------EGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPV 124 G + + EG + ++A R +GMVFQ F L+PHLTVLQN+M AP+ Sbjct: 87 IPDAGTVHVSNRRIGVREGSSIKMSDAELARSRARIGMVFQHFALWPHLTVLQNVMEAPL 146 Query: 125 QVRRWPVAQAEATARQLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEP 184 V P + A A +LLERV +A + D +P +LSGGQ+QRV IARALAM+P ILLFDEP Sbjct: 147 HVLGRPRDEVRAEAERLLERVGLAGKMDAFPSRLSGGQKQRVGIARALAMKPDILLFDEP 206 Query: 185 TSALDPEMVREVLDVMRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRF 244 TSALDP +V EVL VMR LA EG TM++ THE+ FAR+VA RVV M GQ++E APP++F Sbjct: 207 TSALDPMLVGEVLQVMRSLALEGATMVIVTHEMEFARQVASRVVFMDAGQVIENAPPEQF 266 Query: 245 FTAPQSDRAKQFLAQ 259 F+APQ+ RA+QFLA+ Sbjct: 267 FSAPQTPRARQFLAR 281 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 299 Length adjustment: 26 Effective length of query: 235 Effective length of database: 273 Effective search space: 64155 Effective search space used: 64155 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory