Align NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)
to candidate WP_012401945.1 BPHY_RS13045 glutamate/aspartate ABC transporter permease GltK
Query= TCDB::Q8YPM7 (381 letters) >NCBI__GCF_000020045.1:WP_012401945.1 Length = 225 Score = 128 bits (322), Expect = 1e-34 Identities = 77/220 (35%), Positives = 127/220 (57%), Gaps = 10/220 (4%) Query: 166 GLRPVSSNLWNGLLLTLLMAAISIVLSFPIGVLLALGRTSNLPVVRWFSILYIEIVRGVP 225 G+ LW G ++TL + ++IV+ G +LAL R S + + WF+ LY+ + R +P Sbjct: 8 GIPGALPTLWTGAIVTLKITILAIVIGIVWGTVLALLRLSGIKPLEWFAKLYVTLFRSIP 67 Query: 226 LIGILFLAQVMLP------LFFAADVRLDRVLRAIAGLVLFSAAYMAENVRGGLQAVSRG 279 L+ +L +++P L +AD+ + R+ A+ LF AAY +E +R G+QAV RG Sbjct: 68 LVMVLLWFFLIVPQVLQNVLGLSADIDI-RLASAMVAFSLFEAAYYSEIIRAGIQAVPRG 126 Query: 280 QVEAAKALGLNTFFVVLLIVLPQALRAVIPALVGQFIGLFKDTSLLSLVGLVELTGIARS 339 QV A+ ALG++ + L+VLPQA RA++P L+ Q I LF+DTSL+ ++ L + A + Sbjct: 127 QVNASYALGMSYPQAMRLVVLPQAFRAMVPLLLTQAIVLFQDTSLVYVISLADFFRTATN 186 Query: 340 ILAQPQFIGRYAEVYLFIGLIYWLFCYSMSLASRRLERQL 379 I + G E+ LF G Y++ C S + L++++ Sbjct: 187 IGDRD---GTNVEMVLFAGACYFVICVVASSLVKSLQKKV 223 Lambda K H 0.332 0.145 0.452 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 225 Length adjustment: 26 Effective length of query: 355 Effective length of database: 199 Effective search space: 70645 Effective search space used: 70645 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory