Align NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)
to candidate WP_012404360.1 BPHY_RS25615 amino acid ABC transporter permease
Query= TCDB::Q8YPM7 (381 letters) >NCBI__GCF_000020045.1:WP_012404360.1 Length = 216 Score = 117 bits (292), Expect = 4e-31 Identities = 70/206 (33%), Positives = 118/206 (57%), Gaps = 6/206 (2%) Query: 174 LWNGLLLTLLMAAISIVLSFPIGVLLALGRTSNLPVVRWFSILYIEIVRGVPLIGILFLA 233 L L T+ ++ +V+ F +G+ + R S+ V + F Y+ RGVP++ L L Sbjct: 14 LLQAALATIGISLTGLVIGFFVGIGVCSARLSSNFVAQRFGGAYVFFFRGVPMLVQLLLV 73 Query: 234 QVMLPLFFAADVRLDRVLRAIAGLVLFSAAYMAENVRGGLQAVSRGQVEAAKALGLNTFF 293 +LP + + ++ AI+ + L SA+Y+AE +RGG + GQ+EAA+ LGL+ Sbjct: 74 YYLLPF---VGINVSPIVAAISAVSLCSASYIAEILRGGFMNIPPGQIEAARMLGLSPLD 130 Query: 294 VVLLIVLPQALRAVIPALVGQFIGLFKDTSLLSLVGLVELTGIARSILAQPQFIGRYAEV 353 ++ I +PQA R +P+LV + + L K +SL+S+VG+ E+T A++I A R E Sbjct: 131 MLRRIQVPQAFRMTLPSLVNEMVLLIKASSLISVVGVAEITRTAQNIAASTY---RPLEA 187 Query: 354 YLFIGLIYWLFCYSMSLASRRLERQL 379 YL GLIY++ C +++L + E +L Sbjct: 188 YLAAGLIYFVICGALALVAHAAEHRL 213 Lambda K H 0.332 0.145 0.452 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 216 Length adjustment: 26 Effective length of query: 355 Effective length of database: 190 Effective search space: 67450 Effective search space used: 67450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory