Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_012402394.1 BPHY_RS15525 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000020045.1:WP_012402394.1 Length = 251 Score = 170 bits (431), Expect = 2e-47 Identities = 95/227 (41%), Positives = 139/227 (61%), Gaps = 2/227 (0%) Query: 5 VMTGQPLLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQAR 64 V++G+P L++ G++ +YG L GVD+ V++GE+V+L+G NGAG++T + I G R Sbjct: 14 VVSGEPALEIAGLQAWYGESHILHGVDLTVSRGEVVTLLGRNGAGRTTTLRAIMGLTGRR 73 Query: 65 TGSVVFEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAEDVE 124 TGS+ GR+ MPTH IA + PE R IF ++ ENL + + + K ++ Sbjct: 74 TGSIRVGGRETISMPTHRIAHCGVGYCPEERGIFSSLSCEENLLLPPPVGD-KSLMMSID 132 Query: 125 KIFTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFE 184 +I+ +FP L+ER +G LSGGEQQML++ R L LLLLDE S GLAP+IV+ + Sbjct: 133 EIYQMFPNLQERRMSQGTRLSGGEQQMLAVARILRTGANLLLLDEISEGLAPVIVQALAR 192 Query: 185 AIRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKEL 231 I L +A G T+ +VEQN A L+ R YVM +G++ KEL Sbjct: 193 MIVTL-KARGYTIVMVEQNFRFAAPLADRFYVMEHGRIVEHFGAKEL 238 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 251 Length adjustment: 24 Effective length of query: 223 Effective length of database: 227 Effective search space: 50621 Effective search space used: 50621 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory