Align Hydroxymethylglutaryl-CoA lyase YngG; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 (characterized)
to candidate WP_012403543.1 BPHY_RS21385 hydroxymethylglutaryl-CoA lyase
Query= SwissProt::O34873 (299 letters) >NCBI__GCF_000020045.1:WP_012403543.1 Length = 315 Score = 251 bits (640), Expect = 2e-71 Identities = 128/283 (45%), Positives = 178/283 (62%) Query: 9 IKEVGPRDGLQNEPVWIATEDKITWINQLSRTGLSYIEITSFVHPKWIPALRDAIDVAKG 68 ++EV PRDGLQ EP W+ T DKI I+QLS G + IE SFV PK IPALRD V Sbjct: 13 VQEVAPRDGLQIEPTWVETADKIALIDQLSTAGFTRIEAGSFVSPKAIPALRDGEAVFTR 72 Query: 69 IDREKGVTYAALVPNQRGLENALEGGINEACVFMSASETHNRKNINKSTSESLHILKQVN 128 I R GV + ALVPN +G E AL +E + MSAS+THNR N+ S SL + Sbjct: 73 IQRRPGVIFVALVPNLKGAERALNARADELNLVMSASQTHNRANMRMSCEASLDAFGDIV 132 Query: 129 NDAQKANLTTRAYLSTVFGCPYEKDVPIEQVIRLSEALFEFGISELSLGDTIGAANPAQV 188 AQ ++ A ++T FGCP+E + ++V+ + +A E GIS ++L DT G ANP QV Sbjct: 133 RLAQHFPVSMNATVATAFGCPFEGKIDEDRVVSIVDAYREMGISGITLADTTGMANPRQV 192 Query: 189 ETVLEALLARFPANQIALHFHDTRGTALANMVTALQMGITVFDGSAGGLGGCPYAPGSSG 248 ++ +L R PA+ + LHFH+TRG LAN++ A + G FD + GGLGGCP+APG+SG Sbjct: 193 ARLVRRVLRRAPADTLTLHFHNTRGLGLANVLAAYEAGARRFDAALGGLGGCPFAPGASG 252 Query: 249 NAATEDIVYMLEQMDIKTNVKLEKLLSAAKWIEEKMGKPLPSR 291 N TED+V M ++M I T + L+KL++ ++ + +G +P + Sbjct: 253 NICTEDLVNMCDEMSIPTGIDLQKLIALSRTLPALLGHDVPGQ 295 Lambda K H 0.315 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 315 Length adjustment: 27 Effective length of query: 272 Effective length of database: 288 Effective search space: 78336 Effective search space used: 78336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory