Align Hydroxymethylglutaryl-CoA lyase YngG; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 (characterized)
to candidate WP_012405800.1 BPHY_RS32925 hydroxymethylglutaryl-CoA lyase
Query= SwissProt::O34873 (299 letters) >NCBI__GCF_000020045.1:WP_012405800.1 Length = 319 Score = 186 bits (471), Expect = 8e-52 Identities = 105/287 (36%), Positives = 160/287 (55%), Gaps = 10/287 (3%) Query: 2 PYPKKVTIKEVGPRDGLQNEPVWIATEDKITWINQLSRTGLSYIEITSFVHPKWIPALRD 61 P+P V I+EVG RDGLQ+ + T+ K WI G IE+ SFV +W+P L D Sbjct: 3 PFPTSVVIREVGLRDGLQSIQTILPTQQKREWIAAAYAAGQREIEVGSFVPARWLPQLAD 62 Query: 62 AIDVAKGIDREKGVTYAALVPNQRGLENALEGGINEACVFMSASETHNRKNINKSTSESL 121 + + + LVPN +G E A++ + V +SAS H+ N+ K+ E++ Sbjct: 63 TAQLVAYAKTLPDLRVSVLVPNLKGAERAIDSRADLMLVPLSASHAHSLANLRKTPDEAV 122 Query: 122 HILKQVN--NDAQKANLTTRAYLSTVFGCPYEKDVPIEQVIRLSEALFEFGISELSLGDT 179 + ++ DA + + T FGC + V +V+R +AL + G +S+ DT Sbjct: 123 AEVARMRAARDAAGSKTLIEGGIGTAFGCTIQGVVDQGEVLRCMQALLDAGADRVSIADT 182 Query: 180 IGAANPAQVETVLEALLARFPANQIAL--HFHDTRGTALANMVTALQMGITVFDGSAGGL 237 +G A+PA V + E AR A + HFHDTRG ALAN+ AL+ G+ FD + G+ Sbjct: 183 VGYASPAAVRDLFEK--ARHIAGERFWCGHFHDTRGLALANVYAALEAGVARFDATLAGI 240 Query: 238 GGCPYAPGSSGNAATEDIVYMLEQMDIKTNVKLEKLLS----AAKWI 280 GGCP+APG+SGNA++ED+ +ML M I+T + +E+LL+ A+W+ Sbjct: 241 GGCPHAPGASGNASSEDLAFMLADMGIETGIDIEQLLALRGQIAQWL 287 Lambda K H 0.315 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 319 Length adjustment: 27 Effective length of query: 272 Effective length of database: 292 Effective search space: 79424 Effective search space used: 79424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory