Align Fructokinase-1; Fructokinase I; OsFKI; EC 2.7.1.4 (characterized)
to candidate WP_012400650.1 BPHY_RS06360 sugar kinase
Query= SwissProt::A2WXV8 (323 letters) >NCBI__GCF_000020045.1:WP_012400650.1 Length = 320 Score = 120 bits (300), Expect = 6e-32 Identities = 99/319 (31%), Positives = 141/319 (44%), Gaps = 12/319 (3%) Query: 8 VVSFGEMLIDFVPTVAGVSLAEAPAFVKAPGGAPANVAIAVARLGGGAAFVGKLGDDEFG 67 V+++GE + FV G LA F K GA NVAI +ARLG ++ ++G D FG Sbjct: 7 VITYGEAMAMFVAAETG-PLASVGQFTKRVAGADLNVAIGLARLGFKVGWMSRVGADSFG 65 Query: 68 RMLAAILRDNGVDDGGVVFDAGARTALAFVTLRADG-EREFMFYRNPSADMLLTHAELNV 126 + + L G+D V DA T + DG + ++R SA L+ + Sbjct: 66 QYVRDTLAQEGIDQACVTTDARYSTGFQLKSKNDDGSDPAVEYFRKGSAASHLSLVDYVD 125 Query: 127 ELIKRAAVFHY-GSISLIAEPCRSAHLRAMEIAKEAGALLSYDPNLREALWPSREEARTK 185 + A H G I+ R ++AG +S+DPNLR LWPSRE T Sbjct: 126 TYVLAARHLHLTGVAPAISRSSRELAFHMAREMRQAGKTISFDPNLRPTLWPSREAMATA 185 Query: 186 ILSIWDHADIVKVSEVELEFLTGIDSVEDDVVMKLWRPTMKLLLVTLGDQGCKYYARDFR 245 + + AD V E E LTG +D L R K ++V LG +G Y Sbjct: 186 LNELATFADWVLPGIGEGEILTGYTKADDIAQFYLDRGA-KGVVVKLGARGAYYRTAADS 244 Query: 246 GAVPSYKVQQ-VDTTGAGDAFVGALLRRIVQDPSSLQDQKKLEEAIKFANACGAITATKK 304 G V + V++ VDT GAGD F ++ S+L + + L +A+ N GA+ Sbjct: 245 GVVAAQPVERVVDTVGAGDGFAVGVV-------SALLEGRTLPQAVVRGNRIGALAIQVI 297 Query: 305 GAIPSLPTEVEVLKLMESA 323 G LPT E+ L A Sbjct: 298 GDSEGLPTRAELDALESDA 316 Lambda K H 0.320 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 320 Length adjustment: 28 Effective length of query: 295 Effective length of database: 292 Effective search space: 86140 Effective search space used: 86140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory