Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_012402387.1 BPHY_RS15485 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_000020045.1:WP_012402387.1 Length = 253 Score = 204 bits (519), Expect = 1e-57 Identities = 108/239 (45%), Positives = 158/239 (66%), Gaps = 7/239 (2%) Query: 9 LLQVKGLKVAYGGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMND---GN 65 +L+V L V YG ++A+ G VR G++VS+IG NGAGK+T + AI G L + G Sbjct: 10 ILEVSSLSVRYGKVEALHGAKIAVRPGQIVSVIGPNGAGKSTLLNAIMGALPITGHAKGG 69 Query: 66 IEYLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAG---ILADI 122 + Y +++ V G+ +VPE R +FA MT+ +NL +GAY RK +AG L + Sbjct: 70 VMYRNENVSHVPIEKRVARGMCLVPEKRELFAGMTVEDNLILGAYRRK-RAGERDYLDQL 128 Query: 123 EKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMVDKIF 182 E +F +FPRL+ER+ Q AGT+SGGE+QMLA+GRALM +P +L+LDEPS+GL+P++V +IF Sbjct: 129 EPVFQLFPRLKERRKQAAGTLSGGERQMLAVGRALMGKPDLLMLDEPSLGLAPLIVKEIF 188 Query: 183 EVVRDVYALGVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDPKVRAAYLG 241 ++ + GV +L+EQNA AL I+D GYV+E+G + + G L +P+V YLG Sbjct: 189 HIISALRQTGVATLLIEQNARAALQISDYGYVLETGELALEGEADALAQNPRVIETYLG 247 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 253 Length adjustment: 24 Effective length of query: 218 Effective length of database: 229 Effective search space: 49922 Effective search space used: 49922 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory