Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_012403749.1 BPHY_RS22450 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_000020045.1:WP_012403749.1 Length = 265 Score = 188 bits (477), Expect = 1e-52 Identities = 106/252 (42%), Positives = 148/252 (58%), Gaps = 9/252 (3%) Query: 1 MALLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTV 60 M+LL V L+ FGG+ AV DV+ ++N GEL+ LIGPNGAGK+T FN++ G P+ G+V Sbjct: 1 MSLLRVSNLSMSFGGVKAVDDVSFDVNPGELLALIGPNGAGKSTCFNIVNGQLRPTRGSV 60 Query: 61 TLDGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPA 120 TLDGH L G P I G+GRTFQ F +TVL+NV +A +H K RL Sbjct: 61 TLDGHELVGMRPRDIWRRGVGRTFQVAATFNSMTVLENVQMALVSHEK--------RLYG 112 Query: 121 FYK-SEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPA 179 +K + + +A+ LL + A+ L+YG +R+E+ ALA PK+L +DEP Sbjct: 113 LWKRAASHFEEEAIALLDQVGMATHAQRACSVLAYGDVKRVEMAVALANRPKLLLMDEPT 172 Query: 180 AGMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEI 239 AGM PQE +L L +R+ E I ++ EH M++V +R+ VL G+LIAQG D I Sbjct: 173 AGMAPQERNDLMALTKRLAIERNIGVLFTEHSMDVVFASADRMIVLARGKLIAQGDADTI 232 Query: 240 KTNKRVIEAYLG 251 + + V Y G Sbjct: 233 RNDANVQAVYFG 244 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 265 Length adjustment: 24 Effective length of query: 230 Effective length of database: 241 Effective search space: 55430 Effective search space used: 55430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory