Align Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 2.1.2.- (characterized)
to candidate WP_012468519.1 GLOV_RS02085 formate-dependent phosphoribosylglycinamide formyltransferase
Query= SwissProt::P33221 (392 letters) >NCBI__GCF_000020385.1:WP_012468519.1 Length = 394 Score = 446 bits (1148), Expect = e-130 Identities = 231/388 (59%), Positives = 282/388 (72%), Gaps = 1/388 (0%) Query: 4 LGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLD 63 +GT L+ AT+++LLGSGELGKEVA+E QRLGVEVIAVDRYADAPAM VAHRSHVI+MLD Sbjct: 3 IGTPLKAGATKLLLLGSGELGKEVALEAQRLGVEVIAVDRYADAPAMQVAHRSHVISMLD 62 Query: 64 GDALRRVVELEKPHYIVPEIEAIATDMLIQLEEEGLNVVPCARATKLTMNREGIRRLAAE 123 +ALRRV+E E+P IVPEIEAI T L++LE+ G V+P ARA LTMNREGIRRLAAE Sbjct: 63 REALRRVIEQERPDLIVPEIEAIDTVFLLELEQAGQRVIPTARAANLTMNREGIRRLAAE 122 Query: 124 ELQLPTSTYRFADSESLFREAVADIGYPCIVKPVMSSSGKGQTFIRSAEQLAQAWKYAQQ 183 EL LPT+ Y FA S + R A IG+PC+VKP+MSSSGKGQ+ +++A ++ AW+YA Sbjct: 123 ELGLPTAPYAFASSAAELRAAADSIGFPCVVKPIMSSSGKGQSVVKTAAEVDTAWQYAMD 182 Query: 184 GGRAGAGRVIVEGVVKFDFEITLLTVSAVDGVHFCAPVGHRQEDGDYRESWQPQQMSPLA 243 G R + VI+EG + FD+EIT LTV G FC P+GH Q GDY ESWQP MSP A Sbjct: 183 GARGASDTVIIEGFIDFDYEITQLTVRHAGGTSFCPPIGHVQIKGDYHESWQPMAMSPAA 242 Query: 244 LERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQDLSEFALH 303 L A+ A V ALGGYG+FGVELF+ GD V+FSEVSPRPHDTGMVT+ISQ+LS+F LH Sbjct: 243 LAEARRQAEMVTTALGGYGIFGVELFIKGDTVLFSEVSPRPHDTGMVTMISQNLSQFELH 302 Query: 304 VRAFLGLPVGGIRQYGPAASAVILPQLTSQNVTFDNVQNAVGA-DLQIRLFGKPEIDGSR 362 VRA LGLPV I P+AS VIL + + V F V A+ ++RLFGKP+ R Sbjct: 303 VRAILGLPVPEILNLAPSASHVILATDSQETVRFTGVAEALSVPTAKLRLFGKPDTRPGR 362 Query: 363 RLGVALATAESVVDAIERAKHAAGQVKV 390 R+GVAL S +A RA+ +A V++ Sbjct: 363 RMGVALTQGASTDEARSRAEASAHCVRI 390 Lambda K H 0.320 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 394 Length adjustment: 31 Effective length of query: 361 Effective length of database: 363 Effective search space: 131043 Effective search space used: 131043 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory