Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate WP_012469656.1 GLOV_RS07900 acetyl-CoA carboxylase biotin carboxylase subunit
Query= metacyc::MONOMER-13597 (509 letters) >NCBI__GCF_000020385.1:WP_012469656.1 Length = 446 Score = 426 bits (1094), Expect = e-123 Identities = 224/445 (50%), Positives = 305/445 (68%), Gaps = 4/445 (0%) Query: 4 FSRVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALDSYL 63 F ++L+ANRGEIA RV++A KE+G+ +AVYS AD ++H K ADE+ IG AP+ SYL Sbjct: 2 FHKILIANRGEIAIRVIRACKELGIKTVAVYSTADADSLHVKLADESVCIGPAPSSQSYL 61 Query: 64 NIEHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLDGKR 123 NI II AAE +AIHPGYGFLSENA+FAE E+ GITFIGPS+E MR + DK+ ++ Sbjct: 62 NINAIISAAELTDAEAIHPGYGFLSENAKFAEICEQCGITFIGPSAESMRVMGDKISARQ 121 Query: 124 LANMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLMDVW 183 GVP PG+ V ++DEA+K+A++IG+P+++KA +GGGG G+ V +Q L + + Sbjct: 122 AVIEHGVPILPGTKENVKTVDEAVKIAKQIGFPVIIKATAGGGGRGMKIVHSQATLANAY 181 Query: 184 ERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKLIEE 243 K A FG D++IEKY V PRH+E Q++ DK+GN + ER+C+IQRR+QK+IEE Sbjct: 182 ATAKAEAQAGFGNPDVYIEKYCVEPRHVEIQVLADKHGNCIHLGERDCSIQRRHQKIIEE 241 Query: 244 APSPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEHPTT 303 AP P L E R++M + IK K +NY ++GT E D S +FYF+E+N R+QVEHP T Sbjct: 242 APCPVLTPETRKAMGDAAIKAAKAVNYSSVGTVEFLL-DKSGEFYFMEMNTRIQVEHPVT 300 Query: 304 ELIFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGFVTYY 363 E+I +DL++ QI+ AAG L + QED+ ++ G AIE RINAED FT G +T Y Sbjct: 301 EMITGVDLIREQIRSAAGLPLRYKQEDI--KITGHAIECRINAEDPF-KFTPCPGKITAY 357 Query: 364 REPTGPGVRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALADYKIGGIKTT 423 +P G GVRVDS + V P+YDS++ KLIV+ E+RE AI+ RAL +Y I GIKTT Sbjct: 358 HQPGGLGVRVDSFVYDQYTVVPHYDSMIGKLIVHAETREDAIRRMARALDEYIIEGIKTT 417 Query: 424 IELYKWIMQDPDFQEGKFSTSYISQ 448 I +K IM + DF EG TS++ + Sbjct: 418 IFFHKRIMTNKDFIEGNVDTSFLDR 442 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 531 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 446 Length adjustment: 33 Effective length of query: 476 Effective length of database: 413 Effective search space: 196588 Effective search space used: 196588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory