GapMind for catabolism of small carbon sources

 

Alignments for a candidate for pccA2 in Trichlorobacter lovleyi SZ

Align acyl CoA carboxylase biotin carboxyl carrier protein subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate WP_012471291.1 GLOV_RS16140 biotin/lipoyl-containing protein

Query= metacyc::MONOMER-13596
         (167 letters)



>NCBI__GCF_000020385.1:WP_012471291.1
          Length = 965

 Score = 42.4 bits (98), Expect = 2e-08
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 114 VNEGDAVNKGQPLLSVEAMKSETIISAPIAGIVEKIIVKPGQG--VKKGDTLLII 166
           V+EG    K QPL  +E MK    I AP AG ++KII++ G G  V+KG  L  I
Sbjct: 881 VSEGMHFEKDQPLYIIEVMKMFNTIRAPFAGTLDKIIMEGGDGTIVQKGQPLFKI 935


Lambda     K      H
   0.313    0.136    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 359
Number of extensions: 18
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 167
Length of database: 965
Length adjustment: 30
Effective length of query: 137
Effective length of database: 935
Effective search space:   128095
Effective search space used:   128095
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory