Align alginate biosynthesis protein AlgA; EC 2.7.7.13; EC 5.3.1.8 (characterized)
to candidate WP_317623571.1 CLIM_RS11050 mannose-1-phosphate guanylyltransferase
Query= CharProtDB::CH_121570 (483 letters) >NCBI__GCF_000020465.1:WP_317623571.1 Length = 375 Score = 169 bits (429), Expect = 1e-46 Identities = 109/362 (30%), Positives = 186/362 (51%), Gaps = 15/362 (4%) Query: 4 VILSGGSGSRLWPLSRKQFPKQFLALTGEHTLFQQTLERLV-FEGMDTPIVVCNKDHRFI 62 VI++GGS LWP +RK+ P Q L L T+F T+ R+ + IV+ +++ R Sbjct: 15 VIMAGGSAKALWPAARKKQPAQCLELFQLDTMFLLTVRRIASLVPPERIIVISSREGREC 74 Query: 63 VNEQLANRKLECQRILMEPFGRNTAPAVALTAMMLVNEGRDELMLVLPADHVIDDQKALQ 122 + + + I+ EP RNTAP +AL + D + +VLP+DH + D ++ Sbjct: 75 IIA--GGTDISPENIIAEPSARNTAPCIALATAHIKKRDPDAVTVVLPSDHDVRDVESFI 132 Query: 123 RALALAT-VAAERGEMVLFGVPATRPETGYGYIKSTNDS--LLPEG------VSRVQQFV 173 + L + +AAE+ ++ G+ T PET YGYI+S S + PE + RV+ F Sbjct: 133 KILEVGIRIAAEKKGLITIGLTPTYPETEYGYIQSAGHSEEMPPEDGEHGYKLFRVKTFA 192 Query: 174 EKPDEKRAVEFVKSGGYFWNSGMFLFRASRFLEELKKHDPDIYDTCVLTLERSEQTADTV 233 EKPD AV+F++S +FWNSG+F++ E ++ P++Y + E + Sbjct: 193 EKPDYATAVQFLESRDFFWNSGVFIWHIDAICREFERSMPELYKDLLTIHEHLGTDTEDE 252 Query: 234 TLDDATFACCPDNSIDYAVMEKTQRACVVPLSAGWSDVGCWASLWAVN-DKDIHGNVSKG 292 ++D ++ SID+ +MEK ++ GWSD+ CW + ++ + + + Sbjct: 253 VIED-VYSWIHPVSIDHGIMEKADPVYMLAGDFGWSDLVCWDEVARISASHENPEDTCEL 311 Query: 293 DVVIQDSRNCMIH-GNGKLVSVIGLDNIVVVETKDAMMIAHKDKVQGVKQMVSTLNDQGR 351 DV+ +S + GKLV ++G+ +++VV+T D +MI +K V +V L + R Sbjct: 312 DVIRMESSGVFLRKPQGKLVCLLGVKDLIVVDTGDVLMICNKGDTGKVSAIVDLLRRENR 371 Query: 352 SE 353 E Sbjct: 372 EE 373 Lambda K H 0.319 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 473 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 483 Length of database: 375 Length adjustment: 32 Effective length of query: 451 Effective length of database: 343 Effective search space: 154693 Effective search space used: 154693 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory