Align Fructokinase; D-fructose kinase; Manno(fructo)kinase; EC 2.7.1.4 (characterized)
to candidate WP_012506852.1 PAES_RS11575 ROK family protein
Query= SwissProt::P23917 (302 letters) >NCBI__GCF_000020625.1:WP_012506852.1 Length = 298 Score = 228 bits (581), Expect = 1e-64 Identities = 131/302 (43%), Positives = 179/302 (59%), Gaps = 19/302 (6%) Query: 4 GIDLGGTKTEVIALGDAGEQLYRHRLPTPR-DDYRQTIETIATLVD-MAEQA-TGQRGTV 60 GIDLGGTK E + L +A L R RL T + YR ++ I L+D MA QA T T+ Sbjct: 6 GIDLGGTKIEGVVLDEALRPLVRIRLATEACNGYRHVLQRIVELIDRMALQAGTSPPSTI 65 Query: 61 GMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDGAA- 119 G+G PGSI TGV+KN+N+ LNG+PF D+ A L+R+V + NDANC A++E G+ Sbjct: 66 GIGTPGSIDVRTGVIKNSNTLCLNGKPFRSDIEALLERQVLVDNDANCFALAEYRMGSGK 125 Query: 120 --AGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYREEVPCY 177 + + TVF +I+GTG G G+ GR H G G AGEWGHN L E PCY Sbjct: 126 MLSDSATVFGIILGTGVGGGIVCGGRLHHGAQGIAGEWGHNELIPGGE---------PCY 176 Query: 178 CGKQGCIETFISGTGFAMDYRRLSGHALKGSEIIRLVEESDPVAELALRRYELRLAKSLA 237 CG++GC+ET ISG Y L+G + + + D + + R + K+LA Sbjct: 177 CGRRGCVETVISGPALERYYSNLTG---QEKALAAIASGDDDASRRTIARLQEYFGKALA 233 Query: 238 HVVNILDPDVIVLGGGMSNVDRLY-QTVGQLIKQFVFGGECETPVRKAKHGDSSGVRGAA 296 V+N+LDPD++++GGG+ N+D LY Q+V I VF G +TPV + + GDS+GV GAA Sbjct: 234 GVINVLDPDMVIIGGGVGNIDALYSQSVRYRIASHVFNGSFDTPVVRPRLGDSAGVFGAA 293 Query: 297 WL 298 L Sbjct: 294 LL 295 Lambda K H 0.318 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 298 Length adjustment: 27 Effective length of query: 275 Effective length of database: 271 Effective search space: 74525 Effective search space used: 74525 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory