GapMind for catabolism of small carbon sources

 

Protein WP_009568266.1 in Acidithiobacillus ferrooxidans ATCC 23270

Annotation: NCBI__GCF_000021485.1:WP_009568266.1

Length: 223 amino acids

Source: GCF_000021485.1 in NCBI

Candidate for 48 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-lysine catabolism hisP med Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 40% 82% 154.1 cell division ATP-binding protein ftsE 54% 224.6
L-asparagine catabolism bgtA med ATPase (characterized, see rationale) 41% 75% 135.6 cell division ATP-binding protein ftsE 54% 224.6
L-aspartate catabolism bgtA med ATPase (characterized, see rationale) 41% 75% 135.6 cell division ATP-binding protein ftsE 54% 224.6
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 39% 67% 148.7 cell division ATP-binding protein ftsE 54% 224.6
L-asparagine catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 38% 89% 141.7 cell division ATP-binding protein ftsE 54% 224.6
L-aspartate catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 38% 89% 141.7 cell division ATP-binding protein ftsE 54% 224.6
L-glutamate catabolism gltL lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 38% 89% 141.7 cell division ATP-binding protein ftsE 54% 224.6
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 36% 87% 141.4 cell division ATP-binding protein ftsE 54% 224.6
L-arginine catabolism artP lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 37% 89% 139.8 cell division ATP-binding protein ftsE 54% 224.6
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 86% 139.8 cell division ATP-binding protein ftsE 54% 224.6
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 86% 139.8 cell division ATP-binding protein ftsE 54% 224.6
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 86% 139.8 cell division ATP-binding protein ftsE 54% 224.6
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 37% 89% 139.8 cell division ATP-binding protein ftsE 54% 224.6
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 86% 139.8 cell division ATP-binding protein ftsE 54% 224.6
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 86% 139.8 cell division ATP-binding protein ftsE 54% 224.6
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 36% 84% 139 cell division ATP-binding protein ftsE 54% 224.6
L-histidine catabolism hisP lo histidine transport ATP-binding protein hisP (characterized) 37% 89% 137.1 cell division ATP-binding protein ftsE 54% 224.6
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 35% 83% 136.3 cell division ATP-binding protein ftsE 54% 224.6
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 35% 92% 135.6 cell division ATP-binding protein ftsE 54% 224.6
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 35% 92% 135.6 cell division ATP-binding protein ftsE 54% 224.6
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 36% 52% 133.7 cell division ATP-binding protein ftsE 54% 224.6
D-maltose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 37% 64% 131.3 cell division ATP-binding protein ftsE 54% 224.6
sucrose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 37% 64% 131.3 cell division ATP-binding protein ftsE 54% 224.6
trehalose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 37% 64% 131.3 cell division ATP-binding protein ftsE 54% 224.6
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 34% 61% 127.9 cell division ATP-binding protein ftsE 54% 224.6
D-mannitol catabolism mtlK lo MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 35% 58% 125.6 cell division ATP-binding protein ftsE 54% 224.6
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 34% 58% 124.8 cell division ATP-binding protein ftsE 54% 224.6
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 34% 58% 124.8 cell division ATP-binding protein ftsE 54% 224.6
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 124.4 cell division ATP-binding protein ftsE 54% 224.6
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 124.4 cell division ATP-binding protein ftsE 54% 224.6
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 124.4 cell division ATP-binding protein ftsE 54% 224.6
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 124.4 cell division ATP-binding protein ftsE 54% 224.6
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 124.4 cell division ATP-binding protein ftsE 54% 224.6
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 124.4 cell division ATP-binding protein ftsE 54% 224.6
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 124.4 cell division ATP-binding protein ftsE 54% 224.6
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 124.4 cell division ATP-binding protein ftsE 54% 224.6
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 124.4 cell division ATP-binding protein ftsE 54% 224.6
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 33% 57% 123.2 cell division ATP-binding protein ftsE 54% 224.6
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 33% 64% 119.4 cell division ATP-binding protein ftsE 54% 224.6
D-cellobiose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 33% 56% 119 cell division ATP-binding protein ftsE 54% 224.6
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 33% 56% 119 cell division ATP-binding protein ftsE 54% 224.6
D-glucose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 33% 56% 119 cell division ATP-binding protein ftsE 54% 224.6
lactose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 33% 56% 119 cell division ATP-binding protein ftsE 54% 224.6
D-maltose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 33% 56% 119 cell division ATP-binding protein ftsE 54% 224.6
sucrose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 33% 56% 119 cell division ATP-binding protein ftsE 54% 224.6
trehalose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 33% 56% 119 cell division ATP-binding protein ftsE 54% 224.6
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 35% 56% 118.6 cell division ATP-binding protein ftsE 54% 224.6
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 33% 57% 114.8 cell division ATP-binding protein ftsE 54% 224.6

Sequence Analysis Tools

View WP_009568266.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIEFINVTKHYPGRHHVLREVNLRLRKGEMALLTGPSGAGKSTLLKLLLRLEDVSHGTLM
VNGIDVSTLRRRHIPAYRRRIGVVFQDHKLLMDRDVFSNVALTLQVGGLSGRQVQSRVRA
ALEKVGLGNRAQDFPAILSGGEQQRVGIARAIVHTPEILLADEPTGNLDQSLSTEILDLF
RDFHHHGTTVLVATHDQSQVNRLGLPVFHLEQGHLHTPGEDNA

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory