Align 2-aminomuconate semialdehyde dehydrogenase (EC 1.2.1.32) (characterized)
to candidate WP_012536996.1 AFE_RS09825 aldehyde dehydrogenase family protein
Query= metacyc::MONOMER-13349 (490 letters) >NCBI__GCF_000021485.1:WP_012536996.1 Length = 506 Score = 339 bits (870), Expect = 1e-97 Identities = 188/492 (38%), Positives = 282/492 (57%), Gaps = 17/492 (3%) Query: 2 KQYRNYINGEWVESARR--FDDVNPVDGTVVAQVHEADREAVDSAIRAGHAAVRGAWGRT 59 ++Y N+I G WV R FD+++P++G Q+ + E ++ A+ A HAA + AWGRT Sbjct: 17 ERYDNFIGGRWVAPVRGEYFDNISPINGKPFCQIPRSSAEDIELALDAAHAA-KDAWGRT 75 Query: 60 TVAERAAILCRIADEIDRRYDDFLAAEIADTGKPVAMASTIDIPRGAANFRVFADILKTA 119 +V R+ IL +IAD ID + AE D GK V D+P + +FR FA L+ Sbjct: 76 SVTARSNILLKIADRIDANLEMLAVAETWDNGKAVRETLNADVPLSSDHFRYFAGCLRAQ 135 Query: 120 PLDTFQTDLPDGARALNYAVRKPLGVVGVISPWNLPLLLLTWKIAPALACGNAVVAKPSE 179 + D + Y +PLGVVG I PWN PLL+ WK+APALA GN VV KP+E Sbjct: 136 EGTIGEID----ENTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALAAGNCVVLKPAE 191 Query: 180 ETPGTATLLAEVMHTVGVPPGVFNLVHGFGPDSAGEFITTNDDIDAITFTGESRTGSAIM 239 +TP + ++ E++ + +P GV N+V+G+G + AG+ + T+ I I FTG + GS IM Sbjct: 192 QTPASILVMMELIADL-LPAGVLNVVNGYGVE-AGKALATSKRIAKIAFTGSTPVGSLIM 249 Query: 240 RAAATHVKPVSFELGGKNAAIIFADC-DFE-----KMIDGMMRAVFLHSGQVCLCAERVY 293 + AA ++ P + ELGGK+ I FAD D E K ++G + A F + G+VC C R+ Sbjct: 250 KYAAENIIPSTVELGGKSPNIFFADVLDQEDAFVSKAVEGAVLA-FFNQGEVCTCPSRLL 308 Query: 294 VERPIYNRFLDAFVERVKALKLGWPQDGTTGMGPLISAEHRDKVLSYFKLAREEGAQVLV 353 ++ IY +F+ VER +K G P D +G S E DK+LSY ++ ++EGA+V+ Sbjct: 309 IQESIYEKFIGMVVERSAQIKRGNPLDTEVMVGAQASQEQYDKILSYIQIGKDEGAEVIT 368 Query: 354 GGGVPKFGDARDAGFWVEPTIITGLPQTARCIKEEVFGPICHVSPFDTEAEAIALANDTK 413 GG V G++++PT++ G R +EE+FGP+ V+ F EAEA+A+AND + Sbjct: 369 GGAVETMSADYCEGYYIQPTLLKGT-NNMRVFQEEIFGPVVSVTTFKDEAEALAIANDIE 427 Query: 414 YGLSATTWTGNLNRGHRVSEAMRVGLSWVNSWFLRDLRTPFGGVGLSGIGREGGMHSLNF 473 +GL A WT ++NR +R+ ++ G W N + + FGG SG+GRE L+ Sbjct: 428 FGLGAGVWTRDMNRAYRMGRGIQAGRVWTNCYHMYPAHAAFGGYKKSGVGRETHKMMLDH 487 Query: 474 YSELTNVCVRID 485 Y + N+ V D Sbjct: 488 YQQTKNLLVSYD 499 Lambda K H 0.321 0.137 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 585 Number of extensions: 25 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 490 Length of database: 506 Length adjustment: 34 Effective length of query: 456 Effective length of database: 472 Effective search space: 215232 Effective search space used: 215232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory