Align Arabinose-proton symporter; Arabinose transporter (characterized)
to candidate WP_012537116.1 AFE_RS10630 sugar porter family MFS transporter
Query= SwissProt::P96710 (464 letters) >NCBI__GCF_000021485.1:WP_012537116.1 Length = 452 Score = 286 bits (731), Expect = 1e-81 Identities = 157/441 (35%), Positives = 249/441 (56%), Gaps = 12/441 (2%) Query: 24 ILISCAAGLGGLLYGYDTAVISGAIGFLKDLYSLSPFMEGLVISSIMIGGVVGVGISGFL 83 ILI+ AGLGGLL+GYDT V++G + FL ++ M+GL ++ + VG +G L Sbjct: 16 ILIAIVAGLGGLLFGYDTGVVAGVLLFLNHVFHFDASMKGLFVAIALAAAAVGAAFAGAL 75 Query: 84 SDRFGRRKILMTAALLFAISAIVSALSQDVSTLIIARIIGGLGIGMGSSLSVTYITEAAP 143 +D FGRR +L+ AA+LF+ AI+++++ + L + R++ G IG+ S ++ Y++E Sbjct: 76 ADAFGRRAVLIVAAVLFSAGAILASVAWTIPVLFLGRVMVGAAIGVSSMITPLYLSEITA 135 Query: 144 PAIRGSLSSLYQLFTILGISATYFINLAVQRSGTYEWGVHTGWRWMLAYGMVPSVIFFLV 203 RG++ ++ Q + +GI +Y ++ + GV GWRWMLA G +P I Sbjct: 136 AHWRGAIVTINQFYITVGIFLSYVVDYMLS-------GVTDGWRWMLAIGAIPGFILLGG 188 Query: 204 LLVVPESPRWLAKAGKTNEALKILTRINGETVAKEELKNIENSL--KIEQMGSLSQLFKP 261 ++++PESPRWLA +A L + G EEL ++ + + S L + Sbjct: 189 MMILPESPRWLAGRDLIEKATAGLRFLRGRQDVSEELGDLRRDVVEGSRRAAPWSLLLER 248 Query: 262 GLRKALVIGILLALFNQVIGMNAITYYGPEIFKMMGFGQ-NAGFVTTCIVGVVEVIFTVI 320 +RK L+IGI LA+F Q+ G+N + Y+ P IF+ G + + T +G V VI T + Sbjct: 249 KVRKPLIIGIGLAVFQQITGINVVIYFAPTIFQDAGLSSASVSILATVGIGAVNVIMTSV 308 Query: 321 AVLLIDKVGRKKLMSIGSAFMAIFMILIGTSFYFELTSGIMMIV--LILGFVAAFCVSVG 378 A+ L+D GR+K++ G M + +I+IG F +L + I+ ++ FVA F + +G Sbjct: 309 AMRLLDTAGRRKILLFGLCGMLVSLIVIGIGFMIQLHGALAYIIVGMVAIFVAFFAIGLG 368 Query: 379 PITWIMISEIFPNHLRARAAGIATIFLWGANWAIGQFVPMMIDSFGLAYTFWIFAVINIL 438 PI W+MISEIFP +R RA IAT+ W +N I ++ G TF +A + +L Sbjct: 369 PIFWLMISEIFPLAIRGRAMSIATVANWVSNMVISGIFLDLLLMIGRGPTFIFYASMTVL 428 Query: 439 CFLFVVTICPETKNKSLEEIE 459 LF + I PETK K+LE+IE Sbjct: 429 AILFTLWIVPETKGKTLEQIE 449 Lambda K H 0.327 0.142 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 511 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 452 Length adjustment: 33 Effective length of query: 431 Effective length of database: 419 Effective search space: 180589 Effective search space used: 180589 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory