Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_009568266.1 AFE_RS12635 cell division ATP-binding protein FtsE
Query= uniprot:D4GP39 (383 letters) >NCBI__GCF_000021485.1:WP_009568266.1 Length = 223 Score = 114 bits (286), Expect = 2e-30 Identities = 79/225 (35%), Positives = 115/225 (51%), Gaps = 21/225 (9%) Query: 8 DVTKVYTDEGGGDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVTEGELRL 67 +VTK Y G + E++L + GE +L GPSG GKST L+++ LE V+ G L Sbjct: 6 NVTKHYP----GRHHVLREVNLRLRKGEMALLTGPSGAGKSTLLKLLLRLEDVSHGTL-- 59 Query: 68 EDRVLNGVS----------AQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIR 117 ++NG+ A R I +VFQ + L + V N++ L+ GL +++ Sbjct: 60 ---MVNGIDVSTLRRRHIPAYRRRIGVVFQDHKLLMDRDVFSNVALTLQVG-GLSGRQVQ 115 Query: 118 QRVEETTDMLGISDLLDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAE 177 RV + +G+ + P LSGG+QQRV + RAIV PE+ L DEP NLD L E Sbjct: 116 SRVRAALEKVGLGNRAQDFPAILSGGEQQRVGIARAIVHTPEILLADEPTGNLDQSLSTE 175 Query: 178 MRTELQRLQGELGVTTVYVTHDQTEAMTMGDRVAVLDDGELQQVG 222 + +L R G T + THDQ++ +G V L+ G L G Sbjct: 176 I-LDLFRDFHHHGTTVLVATHDQSQVNRLGLPVFHLEQGHLHTPG 219 Score = 24.6 bits (52), Expect = 0.003 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 9/56 (16%) Query: 202 EAMTMGDRV----AVLDDGELQQVGTPLDCYHRPNNLFVAGFIGEPSMNLFDGSLS 253 E + +G+R A+L GE Q+VG H P L EP+ NL D SLS Sbjct: 123 EKVGLGNRAQDFPAILSGGEQQRVGIARAIVHTPEILLA----DEPTGNL-DQSLS 173 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 383 Length of database: 223 Length adjustment: 26 Effective length of query: 357 Effective length of database: 197 Effective search space: 70329 Effective search space used: 70329 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory