Align L-lysine 6-transaminase (EC 2.6.1.36) (characterized)
to candidate WP_009562813.1 AFE_RS01930 aspartate aminotransferase family protein
Query= BRENDA::P9WQ77 (449 letters) >NCBI__GCF_000021485.1:WP_009562813.1 Length = 388 Score = 135 bits (341), Expect = 2e-36 Identities = 127/410 (30%), Positives = 179/410 (43%), Gaps = 46/410 (11%) Query: 41 RSGGSYLVDAITGRRYLDMFTFVASSALGMNPPALVDDREFHAELMQAALNKPSNSDVYS 100 R G +L D GRRYLD +A LG + PA+ L A S++Y Sbjct: 16 RGEGVWLYDT-EGRRYLDALAGIAVCGLGHSHPAVT------RALQTQAGQLLHTSNLYR 68 Query: 101 V-AMARFVETFARVLGDPALPHLFFVEGGALAVENALKAAFDWKSRHNQAHGIDPALGTQ 159 + A + +T V G A FF GA A E A+K A H GI Q Sbjct: 69 IPAQEKLSDTLCAVSGMDAA---FFCNSGAEANEAAIKIA----RLHGHGKGIAEP---Q 118 Query: 160 VLHLRGAFHGRSGYTLSLTNT---KPTITARFPKFDWPRIDAPYMRPGLDEPAMAALEAE 216 +L AFHGR+ TL+ T + + P F + APY Sbjct: 119 ILVFSNAFHGRTLATLTATGNFRIQEGFSPLLPGF----VRAPY---------------G 159 Query: 217 ALRQARAAFETRPHDIACFVAEPIQGEGGDRHFRPEFFAAMRELCDEFDALLIFDEVQTG 276 L RA + P I +AEP+QGEGG R F +RE+CD LL+ DEVQTG Sbjct: 160 DLSTVRALVQANP-GICAILAEPLQGEGGVRPAPEGFLTGLREVCDAHGLLLMLDEVQTG 218 Query: 277 CGLTGTAWAYQQL-DVAPDIVAFGKKTQVCGVMAGRRVDEVADNVFAVPSRLNSTWGGNL 335 G TG +AYQQ+ + PD+++ K GV G + + P + +T+GG Sbjct: 219 IGRTGAFFAYQQIPGLRPDVLSLAKGLG-NGVPIGAMLAGQSTAALFGPGKHGTTFGGGP 277 Query: 336 TDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFPAVVLDPRGRGLMCAFSLPT 395 A+ +L+ ++ E L A + G LR RL + P VL+ RG GLM L Sbjct: 278 LVCAAAQAVLDTMQQEDLPAHAGRMGALLRQRLQKRLGGHPE-VLEIRGMGLMVGIELAH 336 Query: 396 TADRDELIRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSAL 445 +R L+ + + +++ +R PPL + AEID +A + S L Sbjct: 337 KPER--LVERALEAGLLINVTAEKVIRLLPPLILQEAEIDLLVAGLASLL 384 Lambda K H 0.323 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 449 Length of database: 388 Length adjustment: 32 Effective length of query: 417 Effective length of database: 356 Effective search space: 148452 Effective search space used: 148452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory