Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_012537553.1 AFE_RS13865 LPS export ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_000021485.1:WP_012537553.1 Length = 241 Score = 125 bits (315), Expect = 6e-34 Identities = 76/247 (30%), Positives = 127/247 (51%), Gaps = 26/247 (10%) Query: 9 LLQVKGLKVAYGGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDGNIEY 68 LLQ + L +Y V+ V +V GE+V L+G NGAGKTTT + G + + G+I Sbjct: 4 LLQAQSLFKSYRRRVVVRDVSVQVATGEVVGLLGPNGAGKTTTFYMMVGLVRPDRGHIFL 63 Query: 69 LGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAGILADIEKMFTI 128 + I + + GL +P+ VF +M+ +N +LA +E + Sbjct: 64 QQRDITALPMHERARMGLGYLPQEPSVFRQMSAADN-------------VLAVLETLPLS 110 Query: 129 FPRLRERKDQLAG-------------TMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSP 175 +ER++QL ++SGGE++ + + RAL P+ +LLDEP G+ P Sbjct: 111 PVERQERQEQLLSELHLHALRDTKGHSLSGGERRRVEIARALAMSPRFILLDEPFAGIDP 170 Query: 176 IMVDKIFEVVRDVYALGVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDPKV 235 I V +I ++RD+ A G+ +++ + N L I +R Y++ G + G Q++++DP V Sbjct: 171 ISVLEIQRLIRDLRARGIGVLITDHNVRETLGICERAYILHDGKVLTAGSPQEIVDDPMV 230 Query: 236 RAAYLGE 242 R YLG+ Sbjct: 231 RQVYLGD 237 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 241 Length adjustment: 23 Effective length of query: 219 Effective length of database: 218 Effective search space: 47742 Effective search space used: 47742 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory