Align L-2,4-diketo-3-deoxyrhamnonate hydrolase; 2,4-dioxopentanoate hydrolase (characterized)
to candidate WP_012536544.1 AFE_RS06880 fumarylacetoacetate hydrolase family protein
Query= reanno::Smeli:SM_b21112 (281 letters) >NCBI__GCF_000021485.1:WP_012536544.1 Length = 227 Score = 103 bits (258), Expect = 3e-27 Identities = 76/225 (33%), Positives = 107/225 (47%), Gaps = 20/225 (8%) Query: 51 VETLPAVSGNPRLGPCVAGTGKFICIGLNYSDHAAETGATVPPEPIIFMKATSAIVGPND 110 V TL A+S NP + C+G NY+DHA E G+ EP FMK SAI+ N Sbjct: 10 VVTLDAMSSNP------FPVRRIFCVGQNYADHAREMGSAPDTEPFFFMKPASAILRNNS 63 Query: 111 DLVLPRGSEKTDWEVELGIVIGKTAKYVSEAEA-LDYVAGYCTVHDVSERAFQ---TERH 166 L P G+ EVEL + + K K++ + DYV GY D++ R Q E+ Sbjct: 64 VLPYPPGTTDLQPEVELVVALHKGGKHIPTGKVDDDYVFGYAVGLDMTRRDLQRAAREKG 123 Query: 167 GQWTKGKSCDTFGPTGPWLVTKDEVADPQDLA-MWLKVNGETMQDGSTKTMVYGAAHLVS 225 W K+ D P +T + + + LKVNG+ Q M++ +V Sbjct: 124 QPWEMAKAFDHSAPC--TAITPEFYSGTIARGKVELKVNGQIRQSADVGDMLWKIPQIVH 181 Query: 226 YLSQFMSLRPGDIISTGTPPGVGMGMKPPRYLKAGDVVELGIEGL 270 +LS + L PGD++ TGTP GVG +K GDV+E + GL Sbjct: 182 FLSNQVELFPGDLLFTGTPAGVGPVVK-------GDVIEATVAGL 219 Lambda K H 0.315 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 227 Length adjustment: 24 Effective length of query: 257 Effective length of database: 203 Effective search space: 52171 Effective search space used: 52171 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory