Protein WP_012676070.1 in Persephonella marina EX-H1
Annotation: NCBI__GCF_000021565.1:WP_012676070.1
Length: 224 amino acids
Source: GCF_000021565.1 in NCBI
Candidate for 36 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-histidine catabolism | PA5503 | lo | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) | 36% | 66% | 155.6 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| L-arginine catabolism | artP | lo | Arginine transport ATP-binding protein ArtM (characterized) | 39% | 90% | 149.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| L-asparagine catabolism | bgtA | lo | ATPase (characterized, see rationale) | 38% | 83% | 148.3 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| L-aspartate catabolism | bgtA | lo | ATPase (characterized, see rationale) | 38% | 83% | 148.3 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| L-lysine catabolism | hisP | lo | Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) | 36% | 84% | 140.6 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-maltose catabolism | malK1 | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 33% | 58% | 135.6 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| trehalose catabolism | thuK | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 33% | 58% | 135.6 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| L-fucose catabolism | SM_b21106 | lo | ABC transporter for L-Fucose, ATPase component (characterized) | 37% | 56% | 134.8 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-cellobiose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 134.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-glucose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 134.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| lactose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 134.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-maltose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 134.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| sucrose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 134.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| trehalose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 134.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-xylose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 134.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-maltose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 33% | 55% | 134 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-maltose catabolism | malK_Bb | lo | ABC-type maltose transport, ATP binding protein (characterized, see rationale) | 34% | 60% | 132.5 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-galactose catabolism | PfGW456L13_1897 | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 34% | 55% | 128.6 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-mannitol catabolism | mtlK | lo | ABC transporter for D-mannitol and D-mannose, ATPase component (characterized) | 35% | 56% | 127.5 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-sorbitol (glucitol) catabolism | mtlK | lo | ABC transporter for D-Sorbitol, ATPase component (characterized) | 35% | 56% | 125.6 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-maltose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 35% | 58% | 122.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| sucrose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 35% | 58% | 122.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| trehalose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 35% | 58% | 122.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-mannose catabolism | TM1749 | lo | TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) | 34% | 72% | 122.5 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-mannose catabolism | TT_C0211 | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 31% | 55% | 120.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| sucrose catabolism | thuK | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 31% | 55% | 120.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| lactose catabolism | lacK | lo | ABC transporter for Lactose, ATPase component (characterized) | 33% | 58% | 118.2 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-mannose catabolism | TM1750 | lo | TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) | 34% | 65% | 118.2 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-cellobiose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 56% | 115.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-glucose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 56% | 115.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| lactose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 56% | 115.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-maltose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 56% | 115.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| sucrose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 56% | 115.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| trehalose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 56% | 115.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| D-alanine catabolism | AZOBR_RS08250 | lo | Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) | 31% | 81% | 94.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
| L-proline catabolism | AZOBR_RS08250 | lo | Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) | 31% | 81% | 94.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 47% | 222.2 |
Sequence Analysis Tools
View WP_012676070.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MSSIAIKTENLKKIYFLEGAQIDALKGIDLEIYEGEMVALMGPSGSGKSTLLHLIGGIDI
PTEGKVFIHGTDIFSLNEKRLARFRNENIGFVFQFHYLLPEFTALENVMFPVQIYSKGDA
EEKAREILERLGLSHRINHKPSQMSGGEQQRVAIARAIVNRPSIIIADEPTGNLDSRNTE
TVMKIFREMNDKDNVTIIIATHDKDVANYCKRTIYLRDGILVNE
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory