Align galactofuranose ABC transporter putative ATP binding subunit (EC 7.5.2.9) (characterized)
to candidate WP_012591406.1 MSIL_RS12295 ABC transporter ATP-binding protein
Query= ecocyc::YTFR-MONOMER (500 letters) >NCBI__GCF_000021745.1:WP_012591406.1 Length = 311 Score = 105 bits (263), Expect = 2e-27 Identities = 68/217 (31%), Positives = 115/217 (52%), Gaps = 8/217 (3%) Query: 9 ILRTEGLSKFFP-GVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYHADRGTIW 67 I+ GL+K + G KAL +D +R GEI ALLG NGAGK+TLI + G+ + G++ Sbjct: 4 IISISGLTKTYASGFKALKGIDLDIRPGEIFALLGPNGAGKTTLINIICGIVNRTAGSVL 63 Query: 68 LEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPKRFGLLRRKEMEKRAT 127 +G + A A+ L IG V QE++ +V + R GL + Sbjct: 64 ADGHDVVRDYRA-ARSL-IGLVPQELSTDAFETVTSTITFSR-----GLYGKPPNAALIE 116 Query: 128 ELMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQEVELLFDL 187 +L+ + S M++ V I +A+ K+L LDEPTA +D + ++ + Sbjct: 117 KLLRDLSLWDKKNSKIMTLSGGMKRRVMIAKALSHEPKILFLDEPTAGVDVELRRDMWAM 176 Query: 188 MRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGSFV 224 +R LR++GV++I TH++++ +++DR+ V+R G + Sbjct: 177 VRGLREKGVTIILTTHYIEEAEEMADRVGVIRKGELI 213 Score = 83.2 bits (204), Expect = 1e-20 Identities = 56/197 (28%), Positives = 99/197 (50%), Gaps = 13/197 (6%) Query: 280 DLEVRPGEIVGLAGLLGSGRTETAEVIFGIKPADSGTALIKGKPQNLRSPHQASVLGIGF 339 DL++RPGEI L G G+G+T +I GI +G+ L G ++ ++A+ IG Sbjct: 25 DLDIRPGEIFALLGPNGAGKTTLINIICGIVNRTAGSVLADG--HDVVRDYRAARSLIGL 82 Query: 340 CPEDRKTDGIIAAASVRENIILALQAQRGWLRPISRKEQQEIAERFIRQLGIRTPSTEQP 399 P++ TD E + + RG + + E+ +R L + + Sbjct: 83 VPQELSTDAF-------ETVTSTITFSRGLY---GKPPNAALIEKLLRDLSLWDKKNSK- 131 Query: 400 IEFLSGGNQQKVLLSRWLLTRPQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVIS 459 I LSGG +++V++++ L P+ L LDEPT G+DV ++ ++ L G+ +++ + Sbjct: 132 IMTLSGGMKRRVMIAKALSHEPKILFLDEPTAGVDVELRRDMWAMVRGLREKGVTIILTT 191 Query: 460 SELEELVGYADRVIIMR 476 +EE ADRV ++R Sbjct: 192 HYIEEAEEMADRVGVIR 208 Lambda K H 0.321 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 500 Length of database: 311 Length adjustment: 31 Effective length of query: 469 Effective length of database: 280 Effective search space: 131320 Effective search space used: 131320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory