Align ABC transporter for D-glucosamine, permease component 1 (characterized)
to candidate WP_012590720.1 MSIL_RS08675 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_21715 (220 letters) >NCBI__GCF_000021745.1:WP_012590720.1 Length = 384 Score = 109 bits (273), Expect = 6e-29 Identities = 67/217 (30%), Positives = 113/217 (52%), Gaps = 18/217 (8%) Query: 17 LLAGLGLGLELALVSIAIGCVIGLLMAFALLSKHRALRVLASVYVTVIRNTPILVLILLI 76 L G+ + L +A+V + + G+L+A S AL + + ++ ++R PI+ ++ + Sbjct: 171 LWGGIFVSLLVAIVGMVVSLPFGVLLALGRRSSLPALSIACASFIELVRGVPIITVLFMA 230 Query: 77 YFALPSL---GIRLDKLPSFIITLSLYAGAYLTEVFRGGLLSIPKGLREAGLAIGLGEWQ 133 LP + D+L +I ++L+A AY+ EV RGGL +IP G E A+GLG WQ Sbjct: 231 NTMLPLFVPENLAPDRLLRPLIGVALFASAYMAEVVRGGLQAIPSGQFEGAEALGLGRWQ 290 Query: 134 VKAYVTVPVMLRNVLPALSNNFISLFKDTSLAAAIAVPELTYYARKINVESYRVIETW-- 191 + V +P LR V+P + NNFI+LFKDT+L A + + + V+S R+ W Sbjct: 291 TQRLVILPQALRAVIPGVVNNFIALFKDTTLVAVVGIFDFLR-----TVDSARLDPVWAG 345 Query: 192 --LVTTA------LYVAACYLIAMLLRYLEQRLAIRR 220 + TT Y C+ ++ ++E+R + R Sbjct: 346 PTIATTGYAFAAMFYFVFCFAMSRYSLFVERRFSHER 382 Lambda K H 0.329 0.143 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 384 Length adjustment: 26 Effective length of query: 194 Effective length of database: 358 Effective search space: 69452 Effective search space used: 69452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory