Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_049768148.1 MSIL_RS10650 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000021745.1:WP_049768148.1 Length = 249 Score = 343 bits (879), Expect = 2e-99 Identities = 172/237 (72%), Positives = 202/237 (85%) Query: 9 QPLLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSV 68 +PLL + GV YYG I AL GVD+ + +GEIV+LIGANGAGK+TLMMTI G+P+AR G + Sbjct: 12 KPLLSLRGVTAYYGAIIALRGVDLDIREGEIVTLIGANGAGKTTLMMTIFGNPRARDGEI 71 Query: 69 VFEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAEDVEKIFT 128 F G DITR+ TH+IARL +AQSPEGRRIFPRM+V ENLQMGAG+D HF+ED+E+IF Sbjct: 72 RFAGEDITRLDTHKIARLGLAQSPEGRRIFPRMSVYENLQMGAGVDGGGHFSEDLERIFA 131 Query: 129 LFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRK 188 +FPRLKER QRGGTLSGGEQQML+I RALM+RP+LLLLDEPSLGLAPL+VK IFE +R Sbjct: 132 IFPRLKERAGQRGGTLSGGEQQMLAIARALMSRPRLLLLDEPSLGLAPLVVKQIFEVVRD 191 Query: 189 LNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYLEGG 245 LN EGLTVFLVEQNAF AL L+ RA+VMVNG +T+SG+G+ELLA PEVRAAYLEGG Sbjct: 192 LNRREGLTVFLVEQNAFHALSLADRAHVMVNGAITLSGAGRELLARPEVRAAYLEGG 248 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 249 Length adjustment: 24 Effective length of query: 223 Effective length of database: 225 Effective search space: 50175 Effective search space used: 50175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory