Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_012589734.1 MSIL_RS03540 nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >NCBI__GCF_000021745.1:WP_012589734.1 Length = 441 Score = 209 bits (533), Expect = 6e-59 Identities = 114/242 (47%), Positives = 151/242 (62%), Gaps = 7/242 (2%) Query: 4 VSIQAVSRVFETAKGQR-TQALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATS 62 + ++ + + ++T G++ + L V +R N+ V +LG SGCGKS+LLRIV+GL S Sbjct: 15 LEVKNIIQHYQTGSGEQGPRVLDNVSLSLRQNEIVGLLGRSGCGKSSLLRIVSGLVRPAS 74 Query: 63 GRVLLDGAPVEGPGAERGMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAK 122 G V GAPVEGP MVFQS+ LFPWLT+ N+ GLR R P + + RA I Sbjct: 75 GEVSYLGAPVEGPVDGVAMVFQSFALFPWLTVLANVELGLRARKAPREEARRRALKAIDL 134 Query: 123 VGLRGFEQHFPKQLSGGMQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIW 182 +GL GFE FPK+LSGGM+QR ARAL P ILLMDEPF ALD T ++ LL +W Sbjct: 135 IGLDGFESAFPKELSGGMRQRVGFARALVVHPNILLMDEPFSALDVLTAETLRTDLLDLW 194 Query: 183 EAER---KTVLFVTHDIDEAIFMANRVAVFSARPGRIKTELAVDLPHPRHYTIKTSPEFM 239 R K++L VTH+I+EA+ M NR+ V ++ PGRI E+ V L HPR+ + PEF Sbjct: 195 VEGRMPIKSILMVTHNIEEAVLMCNRIIVLASNPGRIAAEIEVTLAHPRN---RLDPEFR 251 Query: 240 DL 241 L Sbjct: 252 QL 253 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 441 Length adjustment: 28 Effective length of query: 231 Effective length of database: 413 Effective search space: 95403 Effective search space used: 95403 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory