Align Extracellular solute-binding protein family 3; Flags: Precursor (characterized, see rationale)
to candidate WP_012590106.1 MSIL_RS05500 transporter substrate-binding domain-containing protein
Query= uniprot:B2TBJ6 (286 letters) >NCBI__GCF_000021745.1:WP_012590106.1 Length = 294 Score = 148 bits (374), Expect = 1e-40 Identities = 96/274 (35%), Positives = 139/274 (50%), Gaps = 32/274 (11%) Query: 15 AVLGAAAIFAAPAQAK-----DWKTVTIALEGGYAPWNLTLPGGKLGGFEPELVANLCER 69 A + A + A P +A+ K + IA EG P+N +L GFE +L LC R Sbjct: 40 AAIALAVVLAPPLRAQAPPQLPPKELVIASEGARPPYNYLDSNNELAGFEIDLGRLLCAR 99 Query: 70 IKLQCNLVAQDWDGMIPGLQAGKFDVLMDAISITPEREKIIAFSKPYAATPATFAVADAK 129 +KLQC V QDWDG+ PGL ++D +M A+ IT E ++ IAFSKPY P+ F Sbjct: 100 MKLQCRFVTQDWDGLTPGLLNRQYDAIMAAMEITDEAKEKIAFSKPYIRMPSAF------ 153 Query: 130 VLPKAAPGAGVVKLSGDPKADQPTVDALRKQLKGKTIGIQSGTVYTKFINDGFKDIATIR 189 + + D K P LKG++IG++SG + +++D +K + IR Sbjct: 154 ----------IASMQSDIKDTTPA------GLKGRSIGVESGGAHQNYLDDLYKQ-SEIR 196 Query: 190 VYKTSPERDLDLANGRIDASFDD---VTYYAANIDKKETASIVMAGPKIGGPIWGPGEGL 246 Y T E LDLA GR+D D ++ + + + + IV P +G G G+ Sbjct: 197 PYATLEEAILDLAEGRLDLVIGDKDAISDFLKSRKEGQCCKIVADAPH-EAAYFGNGVGV 255 Query: 247 AFRKQDADLKAKFDTAISAALADGTVKKLSNKWF 280 RK+D LKA FD AI +ADG+ KL +K+F Sbjct: 256 GLRKEDVALKAMFDKAIDETMADGSFAKLQSKYF 289 Lambda K H 0.316 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 294 Length adjustment: 26 Effective length of query: 260 Effective length of database: 268 Effective search space: 69680 Effective search space used: 69680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory