Align Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate WP_244406241.1 MSIL_RS08680 ABC transporter permease subunit
Query= TCDB::Q9HU29 (230 letters) >NCBI__GCF_000021745.1:WP_244406241.1 Length = 404 Score = 65.9 bits (159), Expect = 1e-15 Identities = 39/129 (30%), Positives = 80/129 (62%), Gaps = 8/129 (6%) Query: 100 LLTMTLHTAAYIAEILRGAIHSVPVGEVEAARALGMSRRQALWHIILPRAVRIGLPAYSN 159 +L ++L+TAA+IAEI+R + +VP G+ EAA A+G++ A +I P+A+R+ +P ++ Sbjct: 276 VLGLSLYTAAFIAEIVRAGVEAVPRGQREAAAAIGLNSAAANRFVIAPQAMRLIVPLLTS 335 Query: 160 EVILMLKASAVVYTVTLFDIMGM-ARTIIARTYESMLFFCLAGALYLVITIVLT------ 212 + + ++K S++ + D++ + A T++ +T ++ + A+YL I+++ + Sbjct: 336 QYLNLIKNSSLAVFIGYPDLVQVFAGTVLNQTGAAVQVIFITMAVYLAISLLASLAMNLY 395 Query: 213 -RIFRLIER 220 R F L+ER Sbjct: 396 GRRFALVER 404 Score = 40.0 bits (92), Expect = 7e-08 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Query: 17 GAALTLELLAIAVVAGLALALP------LGIARASRHWYVRAVPYAYIFFFRGTPLLLQL 70 G A + LL +VA ++LAL +G AR S++W V AY+ R PLLLQL Sbjct: 92 GRAFIVGLLNTLLVAAVSLALATVLGFIVGFARLSKNWIVGQTAMAYVEAVRNVPLLLQL 151 Query: 71 FIVY 74 Y Sbjct: 152 LFWY 155 Lambda K H 0.332 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 230 Length of database: 404 Length adjustment: 27 Effective length of query: 203 Effective length of database: 377 Effective search space: 76531 Effective search space used: 76531 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory