Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate WP_012589734.1 MSIL_RS03540 nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >NCBI__GCF_000021745.1:WP_012589734.1 Length = 441 Score = 143 bits (360), Expect = 7e-39 Identities = 85/198 (42%), Positives = 124/198 (62%), Gaps = 12/198 (6%) Query: 43 LNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAF 102 L++VSL + +I ++G SG GKS+L+R ++ L+ P SGEV + LGA Sbjct: 36 LDNVSLSLRQNEIVGLLGRSGCGKSSLLRIVSGLVRPASGEVSY-------LGAPVEGP- 87 Query: 103 RMRRVSMVFQSFALMPHRTVLQNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYDAKFPH 162 + V+MVFQSFAL P TVL NV G R R +++AR +K ID +GL G+++ FP Sbjct: 88 -VDGVAMVFQSFALFPWLTVLANVELGLRARKAPREEARRRALKAIDLIGLDGFESAFPK 146 Query: 163 QLSGGMKQRVGLARALAADTDVILMDEAFSALDPLIRGDMQDQLLQL---QRNLAKTIVF 219 +LSGGM+QRVG ARAL +++LMDE FSALD L ++ LL L R K+I+ Sbjct: 147 ELSGGMRQRVGFARALVVHPNILLMDEPFSALDVLTAETLRTDLLDLWVEGRMPIKSILM 206 Query: 220 ITHDLDEALRIGSEIAIL 237 +TH+++EA+ + + I +L Sbjct: 207 VTHNIEEAVLMCNRIIVL 224 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 441 Length adjustment: 29 Effective length of query: 246 Effective length of database: 412 Effective search space: 101352 Effective search space used: 101352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory