Align ABC transporter for L-Histidine, permease component (characterized)
to candidate WP_012590203.1 MSIL_RS06000 ABC transporter permease subunit
Query= reanno::pseudo5_N2C3_1:AO356_09615 (283 letters) >NCBI__GCF_000021745.1:WP_012590203.1 Length = 260 Score = 71.2 bits (173), Expect = 2e-17 Identities = 52/185 (28%), Positives = 90/185 (48%), Gaps = 6/185 (3%) Query: 88 LWDKLMQTLALMLVATLISVLIGIPLGILSARSNRLRSVLMPLLDIMQTMPSFVYLIPVL 147 L+ L TL L A L +V+ G+ L +L A+S + +P+ ++Q P + + P+L Sbjct: 55 LFPALFVTLDATLKALLAAVVGGVALAVLFAQSKWIERAFLPVAIVLQVTP-IIAIAPLL 113 Query: 148 MLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVMEAINAFGANRWQQLFGVQLPLA 207 +++ + + A P++ T LG+ VD +++ +GA+RW+ L ++ P A Sbjct: 114 LVYLDASSAVLACAFLVAFFPILSNTALGLASVDRNLVDLFTLYGASRWRMLILLRAPSA 173 Query: 208 LPSIMAGINQTTMMALSMVVIASM-IGARGLGEDVLVGI----QTLNVGRGLEAGLAIVI 262 LP +AG+ +AL + A + GA G G + I LN+ R A L I + Sbjct: 174 LPYFLAGLRIGGGLALVGAIAAELAAGASGKGAGLAFRIVEAGYRLNIPRMFAALLLICL 233 Query: 263 LAVVI 267 V I Sbjct: 234 SGVAI 238 Lambda K H 0.328 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 283 Length of database: 260 Length adjustment: 25 Effective length of query: 258 Effective length of database: 235 Effective search space: 60630 Effective search space used: 60630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory