Align ABC transporter for L-Histidine, permease component (characterized)
to candidate WP_012591145.1 MSIL_RS10910 ABC transporter permease
Query= reanno::pseudo5_N2C3_1:AO356_09615 (283 letters) >NCBI__GCF_000021745.1:WP_012591145.1 Length = 248 Score = 84.3 bits (207), Expect = 2e-21 Identities = 51/174 (29%), Positives = 84/174 (48%), Gaps = 2/174 (1%) Query: 98 LMLVATLISVLIGIPLGILSARSN--RLRSVLMPLLDIMQTMPSFVYLIPVLMLFGLGKV 155 L+ +++LI+ +IG+ L I R + ++ + + QT P L + L G G Sbjct: 63 LVALSSLIAAIIGVGLAIFVTRDSGREFGPLVSAVAAVGQTFPPVAVLALAVPLLGYGAA 122 Query: 156 PAIFATVIYAAPPLIRLTDLGIRQVDGEVMEAINAFGANRWQQLFGVQLPLALPSIMAGI 215 PA+ A +YA P++ G+ V V +A G L ++LPLALP I+AG+ Sbjct: 123 PALAALSLYAILPILEGALTGLANVPFGVRDAARGVGFASRPLLLQIELPLALPFILAGL 182 Query: 216 NQTTMMALSMVVIASMIGARGLGEDVLVGIQTLNVGRGLEAGLAIVILAVVIDR 269 ++ + I S +GA LG +L G+ N L+ G + +LA+ DR Sbjct: 183 RSAVIINIGTAAIGSSVGALSLGSPILEGLSASNPAYILQGGFLVALLAITADR 236 Lambda K H 0.328 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 283 Length of database: 248 Length adjustment: 25 Effective length of query: 258 Effective length of database: 223 Effective search space: 57534 Effective search space used: 57534 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory